InterviewStack.io LogoInterviewStack.io
Browse more Engineering Manager jobs

Engineering Lead – KYC Domain (m/f/d)

Raisin

Berlin, Berlin, Germany6 months ago
74 views19 saves5 applies

Prepare for this role


Benefits

Flexible HoursRetirement Plan

Job Type

full time

Description

Raisin is the world's leading platform for savings and investment products. Founded in 2012, the FinTech connects consumers with banks in the EU, the UK and the US. This gives consumers better interest rates and banks a diversified form of refinancing. Our vision is to offer savings and investments without barriers and thus open up the global 160 trillion euro market.

Raisin currently employs more than 800 people from over 75 countries worldwide. Today, the platform holds over 80 billion euros in assets from more than one million investors which have accrued over 5 billion euros in returns.

Team

The team is part of the “Base Tribe”, which consists of four teams that collaborate closely on the mission: to deliver core functionalities that enable seamless access and interaction with our financial products for customers and internal teams:
As a cross-functional team consisting of web, mobile, backend engineers, the RX Tooling team builds, runs and maintains six microservices written in Python. The team owns the KYC (Know Your Customer) domain, which is responsible for the fast, reliable and secure customer legitimation via integration with external KYC vendors.

The team owns the whole lifecycle from design and development through maintenance of the services at runtime. The team is responsible for the 24/7 runtime support of their services.

Your Team’s Stack

  • Backend: Python (FastAPI), MySQL, Kafka, AWS
  • Web: TypeScript, ReactJS
  • Mobile: TypeScript, React Native

This is not a purely managerial role. You will actively contribute to code, guide technical decisions, and foster engineering excellence, while ensuring reliable delivery and 24/7 operational readiness of your team’s services.


Your Responsibilities

  • You are responsible for the full E2E delivery cycle, from requirements analysis, and effort estimation through design, implementation, QA, delivery, and support.
  • You nurture an inspiring environment with open communication and a culture of trust.
  • Champion in writing clean, maintainable, and efficient code across the team’s tech stack - Python - adhering to best practices in software development. Implement new features and maintain existing codebases to ensure high performance and availability.
  • You proactively resolve impediments and mitigate risks for your team.
  • In case you need to escalate delivery and team risks, you do this in a timely fashion, with a well-articulated solution/mitigation plan.
  • You collaborate closely with your team’s Product Manager.
  • You facilitate the team’s work on strategy and planning for the delivery.
  • With the Product Manager, you drive the OKR process for your team: communication of objectives, Key result definition, team commitment, and pairing OKRs with individual target agreements for your engineers.
  • You recruit, hire, and onboard engineers into the team.
  • You develop your engineers’ soft- and technical skill sets according to the company’s goals and needs.
  • You craft agreements and individual development plans with every team member, aligned to the team's goals.
  • You uncover training opportunities as well as provide coaching for your team.
  • You recognize high performance and reward accomplishments; you act on low performance in a timely manner.
  • You establish and keep strong performance standards for your direct reports.

Your Profile

  • You have a university degree in Computer Science, Engineering, Information Systems, or related fields or equivalent practical experience.
  • You bring at least 2 years of leadership/people management experience in a remote setup and have a strong focus on delivery.
  • You have hands-on experience in technical platform transitions within a company.
  • You have strong hands-on experience (min. 8 years) as a Backend Software Engineer and want to stay one of the main contributors to your team.
  • You know how to manage software projects to a successful delivery in a collaborative fashion.
  • You have up-to-date, in-depth knowledge of the software development lifecycle in modern Frontend and Backend .
  • You need to feel comfortable with Python technologies.
  • You are comfortable with architecture discussions.
  • You bring experience with AWS Services, K8S, and Event-Driven architectures.
  • Prior exposure to the KYC domain is a strong plus.
  • Very good communication skills; Fluency in English; German-language skills are a plus but not mandatory.

Join our mission, join our team – and growth with us!

At Raisin, we care about each other and it is one of our top priorities to foster an open and caring environment in which everyone feels welcome and comfortable. Our culture is strongly driven by our ambitious team, which connects more than 75 different nationalities.

As part of our team, you will benefit from:

  • Employee Development Budget of €2,000 and four full training days per year.
  • Flexible working hours, home office and 30 vacation days.
  • A company pension scheme (Betriebliche Altersvorsorge), which we support with 20%.
  • Enjoy more than 50+ different sports with Urban Sports Club: We subsidize your membership with more than €20 per month.
  • Do you miss being in the office? The Deutschland Ticket gets you there, which we subsidize with €25 per month.
  • Love cycling? With JobRad, lease the bike of your choice and enjoy tax savings, plus Raisin covers your monthly insurance costs.
  • Hungry all the time? Snacks, daily fresh fruit as well as drinks provided at the office.
  • You are moving from another country or city to join us? We may support your relocation.

Raisin Applicant Privacy Policy

We value diversity and the unique experiences each individual brings. If you’re excited about this role but don’t meet every requirement, we still encourage you to apply.

We are an equal opportunity employer and are committed to creating an inclusive environment for everyone, regardless of race, colour, ancestry, religion, sex, national origin, sexual orientation, age, citizenship, marital status, disability, or gender identity.

This job is found at InterviewStack.io

Skills

microservicespythonfastapimysqlkafkaawstypescriptreact nativekubernetesrequirements analysispeople management

About Raisin

Raisin is the world's leading platform for savings and investment products. Founded in 2012, the FinTech connects consumers with financial institutions.

fintech, softwareWebsite