InterviewStack.io LogoInterviewStack.io
Browse more Software Engineer jobs

Software Engineer III

RELX Group

Raleigh, NC$128,305+3 months ago
98 views48 saves9 applies

Prepare for this role


Job Type

full time

Description

  • RELX, Inc. d/b/a LexisNexis USA

  • Software Engineer III

  • Venture III, 900 Main Campus Drive, Raleigh, NC 27606 (formerly 1801 Varsity Drive, Raleigh, NC 27606)

JOB DESCRIPTION:

  • Lead the design of specific software products and introduce new patterns for Microservices FrontEnd (MFE) to support rich, dynamic web experiences and APIs. Develop and implement new features in MFE, implement unit testing, perform integration testing, and user story delivery. Develop APP using AWS Cloud resources, CI/CD pipelines and AWS Serverless technologies. Develop and test client side and server-side code for multiple LexisAdvance and LexisPlus features and migrate the Shepards application in LexisPlus. Migrate the OnPrem projects to AWS Cloud Services in LexisAdvance and lead the design drive and code reviews. Integrate application packages, build and deploy to all DEV and CERT environments which allows the users to use the Lexis applications effectively. Develop technical design documents for new features in LexisPlus, and triage and fix any production issues. Lead the feature team for sprint planning, daily scrums, retrospectives, stakeholder meetings, and Sprint Review meetings and test applications to ensure a standard user experience for the clients across all platforms. Interact with Domain architects about design guidelines on regular basis to understand future design direction. Mentor team members and help them resolve technical issues. Perform other duties as needed.

REQUIREMENTS:

  • Bachelor’s degree (or foreign equivalent) in Computer Science, Computer Engineering, Information Technology, or a related field required.

  • 3 years of experience in job offered or related occupations required.

  • Also required is: 3 years of experience: in client side development utilizing Angular, HTML, CSS, LESS, JavaScript, and Typescript to build, refactor, design, and test client side features, integrating and implementing calls to APIs and other services to provide the data needed to display on various web applications; to design, implement, and refactor UX and UI designs based on Figma specifications to accurately replicate user experiences and layouts; using .Net Core and C# to build, refactor, optimize, and test APIs and other application layer code that supports web applications and other applications across the organization; in maintaining and creating build pipelines using YAML; in Agile Scrum and Kanban, including sprint planning, daily scrum leadership, retrospectives, and other key milestones throughout the Agile process; and in presenting technical demos and knowledge transfer sessions to help train other engineers and to provide examples of working functionality to product management, clients, executives, or UX resources.

  • Employee reports to RELX, Inc. d/b/a LexisNexis USA office in Raleigh, NC, but may telecommute from any location within the U.S.

  • Experience can be concurrent.

SALARY RANGE FOR REQ# R111458:

  • $128,305.84 to $144,400/year + standard company benefits

  • This salary range is specifically for REQ#R111458. Salary range listed below is general and covers all similar positions in the area and should not be considered for this specific position.

 

HOW TO APPLY:

#LI-DNI

#IND-DNS

#ICT

U.S. National Base Pay Range: $78,800 - $131,300. Geographic differentials may apply in some locations to better reflect local market rates.

We know your well-being and happiness are key to a long and successful career. We are delighted to offer country specific benefits. Click here to access benefits specific to your location.

We are committed to providing a fair and accessible hiring process. If you have a disability or other need that requires accommodation or adjustment, please let us know by completing our Applicant Request Support Form or please contact 1-855-833-5120.

Criminals may pose as recruiters asking for money or personal information. We never request money or banking details from job applicants. Learn more about spotting and avoiding scams here.

Please read our Candidate Privacy Policy.

We are an equal opportunity employer: qualified applicants are considered for and treated during employment without regard to race, color, creed, religion, sex, national origin, citizenship status, disability status, protected veteran status, age, marital status, sexual orientation, gender identity, genetic information, or any other characteristic protected by law.

USA Job Seekers:

EEO Know Your Rights.

This job is found at InterviewStack.io

Skills

microservicesunit testingintegration testingawsci/cdangularhtmlcssjavascripttypescriptapisfigma.net corec#agilescrumproduct managementui designuser experiencecode review

About RELX Group

RELX Group is a global provider of information-based analytics and decision tools for professional and business customers. The company operates in sectors including science, medical, legal, risk, and business analytics, serving customers worldwide.

enterprise companytechnology, data_analyticspublicWebsite