InterviewStack.io LogoInterviewStack.io
Browse more Software Engineer jobs

Senior Software Engineer - AI Product Development

Clarivate

Spain - Barcelona1 month ago
99 views36 saves3 applies

Prepare for this role


Benefits

Remote WorkHealth Insurance

Job Type

full time

Description

We’re looking for a passionate and experienced Senior Software Engineer -AI Product Development  to join our AI Innovation Team in Barcelona, part of Clarivate’s Life Sciences & Healthcare division. 
This is a unique opportunity to work on cutting-edge R&D products that are shaping the future of healthcare and scientific discovery. 

In this role, you’ll take technical ownership of key initiatives, contribute to architectural decisions, and collaborate on AI-driven solutions that have real-world impact. 
Our core technologies include Java and Python, and we’re especially interested in connecting with engineers who bring deep expertise in these languages and a strong background in artificial intelligence. 

About You – experience, education, skills, and accomplishments 

  • Bachelor's degree in computer science, Software Engineering, or related field; or equivalent relevant work experience.  

  • At least 6 years of professional software engineering experience in Java and Spring Boot, as well as developing backend RESTful services within a microservices architecture. 

  • At least 6 years of experience with OpenSearch (or similar search engines) and Oracle DB expertise, with experience writing and optimizing SQL queries for relational databases. 

  • At least 2 years of experience with LLM agents/assistants, including all of the following: tool/function calling, retrieval (RAG), and automated evaluations. 

 

It would be great if you also have . . .  

  • Experience running services in docker. 

  • Experience using Jenkins. 

  • Knowledge about AWS cloud infrastructure. 

  • Experience developing backend systems in Python (APIs, microservices, ETL pipelines). 

 

What will you be doing in this role? 

  • Take a role implementing our backend services. 

  • Work as a backend software engineer in a cross-functional team. 

  • Write quality, well-tested, documented code. 

  • Adhere to development best practices and standards as set within the team. 

  • Help support existing systems, diagnosing issues, and identifying bugs. 

  • Work closely with QA, DevOps, Product Owners, Solution Analysts and Project Management.

 

About the Team 

The team works in close partnership with data scientists, product managers, and domain experts across Clarivate’s Life Sciences & Healthcare division to design and deliver next-generation AI capabilities. 

We collaborate closely with internal stakeholders, including R&D, Product, and Platform Engineering teams, and benefit from Clarivate’s strong innovation culture and access to a global engineering community. This provides continuous learning opportunities and exposure to large-scale, high-impact projects. 

The Barcelona-based team operates in a flexible and supportive environment that encourages collaboration, creativity, and ongoing development, while staying connected to Clarivate’s global network of engineering and AI experts. 

 

Hours of Work 

This is a full-time, permanent position, primarily working core business hours in CET, with flexibility to collaborate with teams as needed.

This is a hybrid position working in the office up to 3 days a week.

What we can offer you:

  • 30 working days of vacation

  • Volunteering community offering paid hours of volunteering time

  • Private Health and Life & Disability insurances.

  • Tax-free benefits (Ticket Restaurant scheme, kindergarten, and transport cards)

  • Agile work environment with a team of talented colleagues

  • On-site language classes (Catalan, Spanish and English)

  • Digital workplace with possibility to work in a central office location in Barcelona with global and dynamic employees.

 

At Clarivate, we are committed to providing equal employment opportunities for all  qualified persons with respect to hiring, compensation, promotion, training, and other terms, conditions, and privileges of employment. We comply with applicable laws and regulations governing non-discrimination in all locations.

This job is found at InterviewStack.io

Skills

javapythonspring bootmicroservicessqlllmragawsapisetlagileproject managementrelational databases

About Clarivate

Clarivate is a global company that provides trusted insights and analytics to accelerate the pace of innovation. It offers solutions in scientific and academic research, patent analytics, pharmaceutical and biotech intelligence, and intellectual property management.

enterprise companydata_analytics, technologypublicWebsite