InterviewStack.io LogoInterviewStack.io
Browse more Software Engineer jobs

Sr Software Engineer (Java, Streaming)

FICO

Work from Home, United StatesRemote$122,500 - $192,5002 months ago
98 views35 saves15 applies

Prepare for this role


Job Type

full time

Description

FICO (NYSE: FICO) is a leading global analytics software company, helping businesses in 100+ countries make better decisions. Join our world-class team today and fulfill your career potential!

The Opportunity
 

“We are seeking a senior software engineer to contribute to the technical development of an analytic decisioning platform.  You will be part of a highly energetic team of software engineers to enhance FICO’s streaming platform. This role involves contributing on a backend engineering team responsible for processing of high-volume, low latency decisioning and analytics execution. These capabilities embody patented and unique market value that drives critical business value in a high growth area. This opportunity offers a unique leadership role to work with cutting edge technology applied to one-of-a-kind business problems.” – Software Engineering-Sr Director
 

What You’ll Contribute
 

  • Collaborate with product managers to understand priorities and usage scenarios of product features.
  • Collaborate with architects to drive the design for your software platform capability.
  • Collaborate within working groups of software engineers to follow software engineering standards, guidance, and processes.
  • Continuously improve engineering practices for the software platform to support efficiency, reliability, and serviceability goals.
  • Assist research, case studies and prototypes on technologies to ensure the software platform remains the leading analytic decisioning platform.
  • Coach other software engineers on creating their domain designs while fostering a learning culture.
  • Collaborate with QA engineers to design and implement functional and non-functional tests.
  • Participate in support activities for both cloud and on-premises implementations.


What We’re Seeking
 

  • Detailed understanding of software architecture and design principles, with a focus on building scalable and maintainable systems.
  • Experience in designing, building, deploying, and operating commercial software that provides a composable platform executing in low milliseconds at 10K+ TPS.
  • Significant expertise in Java and Spring with hands-on experience in modern software design patterns and open-source technologies.
  • Experience coaching/mentoring individuals and teams.
  • Technical expertise across deployment models on public cloud, private cloud, and on-premises infrastructure.
  • Proficiency with Kubernetes and Docker for containerized application management.
  • Experience with database technologies such as MySQL, Oracle, or similar enterprise databases.
  • Skilled in Agile processes with outstanding communication abilities to articulate complex information to both technical and non-technical audiences.
  • Proficiency in one or more stream processing platforms such as Storm, Kafka, Flink, Spark Streaming, Kinesis, Dataflow, Pulsar, or Stream Analytics.
  • Experienced in domain-driven, event-driven, and microservice architecture, along with data flow concepts and hands on implementation.
  • Multi-cloud experience (AWS, Google, Azure) and familiarity with technologies like Cassandra, Zookeeper, Kustomize, and/or OpenSearch are preferred.
  • Experience in JavaScript, Angular, Python, and generative AI tools is beneficial.
     

Our Offer to You
 

  • An inclusive culture strongly reflecting our core values:  Act Like an Owner, Delight Our Customers and Earn the Respect of Others.
  • The opportunity to make an impact and develop professionally by leveraging your unique strengths and participating in valuable learning experiences.
  • Highly competitive compensation, benefits and rewards programs that encourage you to bring your best every day and be recognized for doing so.
  • An engaging, people-first work environment offering work/life balance, employee resource groups, and social events to promote interaction and camaraderie.
  • The targeted base pay range for this role is: $122,500 to $192,500 with this range reflecting differences in candidate knowledge, skills and experience.
     

#LI-CG2

#LI-REMOTE

Why Make a Move to FICO?

At FICO, you can develop your career with a leading organization in one of the fastest-growing fields in technology today – Big Data analytics.  You’ll play a part in our commitment to help businesses use data to improve every choice they make, using advances in artificial intelligence, machine learning, optimization, and much more.


FICO makes a real difference in the way businesses operate worldwide:

•    Credit Scoring — FICO® Scores are used by 90 of the top 100 US lenders.

•    Fraud Detection and Security — 4 billion payment cards globally are protected by FICO fraud systems.

•    Lending — 3/4 of US mortgages are approved using the FICO Score.

Global trends toward digital transformation have created tremendous demand for FICO’s solutions, placing us among the world’s top 100 software companies by revenue. We help many of the world’s largest banks, insurers, retailers, telecommunications providers and other firms reach a new level of success. Our success is dependent on really talented people – just like you – who thrive on the collaboration and innovation that’s nurtured by a diverse and inclusive environment. We’ll provide the support you need, while ensuring you have the freedom to develop your skills and grow your career.  Join FICO and help change the way business thinks!

Learn more about how you can fulfil your potential at www.fico.com/Careers

FICO promotes a culture of inclusion and seeks to attract a diverse set of candidates for each job opportunity. We are an equal employment opportunity employer and we’re proud to offer employment and advancement opportunities to all candidates without regard to race, color, ancestry, religion, sex, national origin, pregnancy, sexual orientation, age, citizenship, marital status, disability, gender identity or Veteran status. Research has shown that women and candidates from underrepresented communities may not apply for an opportunity if they don’t meet all stated qualifications. While our qualifications are clearly related to role success, each candidate’s profile is unique and strengths in certain skill and/or experience areas can be equally effective. If you believe you have many, but not necessarily all, of the stated qualifications we encourage you to apply.

Information submitted with your application is subject to the FICO Privacy policy at https://www.fico.com/en/privacy-policy

This job is found at InterviewStack.io

Skills

analyticssoftware architecturejavakubernetesdockermysqlagilekafkaflinksparkawsazurecassandrajavascriptangularpythongenerative aimachine learning

About FICO

FICO is a data analytics company known for its credit scoring services and decision management technology. It provides software and analytics to help businesses make better decisions in areas such as credit risk, fraud detection, and customer management.

large companyfinance, data_analyticspublicWebsite