InterviewStack.io LogoInterviewStack.io
Browse more Full-Stack Developer jobs

Java Full Stack Developer

Solventum

IN, Bangalore Kar2 months ago
40 views20 saves1 applies

Prepare for this role


Benefits

Remote WorkHealth Insurance

Job Type

full time

Description

Thank you for your interest in joining Solventum. Solventum is a new healthcare company with a long legacy of solving big challenges that improve lives and help healthcare professionals perform at their best. At Solventum, people are at the heart of every innovation we pursue. Guided by empathy, insight, and clinical intelligence, we collaborate with the best minds in healthcare to address our customers’ toughest challenges. While we continue updating the Solventum Careers Page and applicant materials, some documents may still reflect legacy branding. Please note that all listed roles are Solventum positions, and our Privacy Policy: https://www.solventum.com/en-us/home/legal/website-privacy-statement/applicant-privacy/ applies to any personal information you submit. As it was with 3M, at Solventum all qualified applicants will receive consideration for employment without regard to their race, color, religion, sex, sexual orientation, gender identity, national origin, disability, or status as a protected veteran.

Job Description:

As a Java Full Stack Developer, you will have the opportunity to tap into your curiosity and collaborate with some of the most innovative and diverse people around the world. Here, you will make an impact by:

· Designing, developing, and maintaining scalable full-stack applications using Java and modern web technologies

· Building and enhancing backend services and APIs using Java, Spring / Spring Boot, and RESTful architectures

· Developing responsive and user-friendly frontend applications using frameworks such as Angular, React, or similar technologies

· Collaborating with product owners, business analysts, and UX teams to translate business requirements into technical solutions

· Ensuring application performance, security, scalability, and maintainability

· Participating in code reviews and promoting best practices across the full stack

· Troubleshooting and resolving application issues across development, test, and production environments

· Supporting CI/CD pipelines, automated testing, and deployment processes

· Working closely with cross-functional teams to deliver high-quality solutions in an Agile environment

Additionally, this role may be asked to engage in above responsibilities with new and evolving technologies and platforms.

---

To set you up for success in this role from day one, Solventum requires (at a minimum) the following qualifications:

· Bachelor’s Degree or higher AND 5+ years of experience in software development with a focus on Java-based applications

---

In addition to the above requirements, the following are also required:

· Strong hands-on experience with Java, Spring, and Spring Boot

· Experience developing RESTful APIs and microservices architectures

· Frontend development experience using Angular, React, JavaScript, TypeScript, HTML, and CSS

· Experience working with relational databases and writing efficient SQL

· Familiarity with CI/CD pipelines, build tools, and version control systems (Git)

· Experience working in Agile/Scrum environments

· Strong problem-solving, debugging, and analytical skills

· Effective communication and collaboration skills

---

Additional qualifications that could help you succeed even further in this role include:

· Experience with cloud platforms such as Azure, AWS, or GCP

· Experience with containerization and orchestration (Docker, Kubernetes)

· Exposure to security best practices and application authentication/authorization

· Experience with automated testing frameworks and test-driven development

· Experience supporting healthcare or other regulated industry applications

· Skills including adaptability, attention to detail, ownership mindset, and the ability to operate in a fast-paced, enterprise environment.

Location: Bangalore (Hybrid)

   

Solventum is committed to maintaining the highest standards of integrity and professionalism in our recruitment process.  Applicants must remain alert to fraudulent job postings and recruitment schemes that falsely claim to represent Solventum and seek to exploit job seekers.

Please note that all email communications from Solventum regarding job opportunities with the company will be from an email with a domain of @solventum.com. Be wary of unsolicited emails or messages regarding Solventum job opportunities from emails with other email domains.

Please note: your application may not be considered if you do not provide your education and work history, either by: 1) uploading a resume, or 2) entering the information into the application fields directly.

Solventum Global Terms of Use and Privacy Statement


Carefully read these Terms of Use before using this website. Your access to and use of this website and application for a job at Solventum are conditioned on your acceptance and compliance with these terms.

Please access the linked document by clicking here. Before submitting your application you will be asked to confirm your agreement with the
terms.

This job is found at InterviewStack.io

Skills

javaapisspring bootangularreactscalabilityci/cdagilerestful apismicroservicesjavascripttypescripthtmlcsssqlgitscrumdebuggingazureawsgcpcontainerizationdockerkubernetesfrontend developmentrelational databasescode reviewautomated testing

About Solventum

Solventum is a new healthcare company with a long legacy spanning over 70 years. Spun off from 3M in April 2024, Solventum enables better, smarter, and safer healthcare by pioneering game-changing innovations at the intersection of health, material science, and data science. With over 22,000 employees operating in 38 countries, Solventum serves customers in more than 90 countries through its four business segments: Medical & Surgical Solutions, Dental Solutions, Health Information Systems, and Purification & Filtration.

enterprise companyhealthcare, medical_devicespublicWebsite