InterviewStack.io LogoInterviewStack.io
Browse more Data Engineer jobs

VP – Data Architecture Governance

Synchrony Financial

Stamford HubRemote$155,000 - $260,0001 month ago
102 views39 saves10 applies

Prepare for this role


Benefits

Remote WorkPerformance Bonus

Job Type

full time

Description

Role Summary/Purpose:

The VP – Data Architecture Governance leader is a strategic leadership role within Synchrony’s Data & Analytics Engineering organization responsible for enterprise data platform architecture governance, risk & controls oversight, and architecture decision leadership. This role ensures enterprise-wide alignment of data architecture standards, reference patterns, and control requirements to support Synchrony’s evolving data landscape and long-term business objectives.

As a leader, you will work extensively with senior architects, engineering teams, Internal Audit, risk and compliance functions to design “controls-by-design” architecture guardrails and ensure they are implemented and evidenced through engineering workflows —across AWS cloud services (e.g., Redshift, EMR, SageMaker, etc.), Ab Initio, Kafka, Hadoop, Oracle, Snowflake and SAS - which collectively support Synchrony’s enterprise-wide data, AI and analytics needs to enable informed decision-making and business growth. You will lead governance activities including issue management, risk & controls assessment, and audit/regulatory coordination (e.g., SOX) , while mentoring teams and promoting architectural excellence.

Our Way of Working

We’re proud to offer you choice and flexibility. At Synchrony, our way of working allows you to have the option to work from home near one of our Hubs or come into one of our offices. Occasionally you may be required to commute to our nearest office for in person engagement activities such as business or team meetings, training and culture events.

Essential Responsibilities:

  • Own the L3 data architecture governance process, ensuring standards, procedures, and job aids are defined, maintained, and aligned with Synchrony’s strategic objectives including cloud modernization efforts.

  • Collaborate with enterprise and domain architects to align data architecture standards and controls across Synchrony.

  • Lead issue and risk management activities for data architecture, including tracking, resolving, and documenting closure of control gaps and audit findings; ; drive root-cause analysis and sustainable remediation (not just closure).

  • Drive coordination of audits, regulatory requests, and certifications (e.g., SOX), ensuring timely responses and remediation.

  • Author and curate executive and regulator ready architecture governance content (e.g., standards, policies, control narratives, procedures, evidence packs, and briefing materials), ensuring clarity, consistency, and auditability.

  • Partner with compliance, risk, business stakeholders and engineering teams to embed controls into data platform processes supporting operational resilience and regulatory compliance.

  • Maintain risk and control documentation and update governance tools to track risk posture and mitigation actions.

  • Communicate progress and risk exposure regularly to senior leadership.

  • Chair/lead architecture design reviews for critical data engineering initiatives (batch + streaming), approving reference patterns for ingestion, transformation, storage, and consumption (APIs, datasets, events) and ensuring alignment to target-state architecture.

  • Define technical guardrails and ensure adherence to approved reference architectures for data domains and products (data modeling, data contracts, metadata/lineage, data quality, security), including standards for cloud-native implementations and migration from legacy platforms.

  • Drive automation of architecture compliance by partnering with platform/DevOps teams to embed controls into engineering workflows (e.g., CI/CD checks, configuration baselines, policy-as-code, automated evidence capture/monitoring).

  • Perform other duties and/or special projects as assigned.

Qualifications / Requirements:

  • Bachelor’s Degree in Computer Science or related field and a minimum 10+ years’ experience in information technology or in lieu of degree, High School/GED and 15+ years of Information technology experience.

  • A minimum of 8 years of progressive experience in governance role supporting engineering org or senior data architecture roles within regulated environments, with preference for financial services.

  • Proven experience owning data platform architecture governance and control frameworks and driving compliance activities from design through implementation and evidence.

  • Strong collaboration skills to work effectively with architects, engineers, risk, and audit teams.

  • Experience managing audit coordination and regulatory compliance activities for technology platforms.

  • Knowledge of industry best practices in data architecture and governance, with focus on cloud modernization initiatives.

  • Strong communication skills, including ability to brief executive leadership on risk and compliance matters.

  • Familiarity with risk management and issue tracking tools and processes is preferred.

  • Ability and flexibility to travel for business as required

Desired Characteristics:

  • Strategic thinker with a strong risk management mindset.

  • Proactive, results-oriented with ability to manage multiple priorities.

  • Influential leader capable of driving change across complex, matrixed organizations.

  • Passion for continuous improvement of data architecture controls and governance.

  • Recognized thought leader with strong technical writing and storytelling skills; able to translate complex architecture and control topics for executive and regulatory audiences.

Grade/Level: 13

                                                                      

The salary range for this position is 155,000.00 - 260,000.00 USD Annual and is eligible for an annual bonus based on individual and company performance.

Actual compensation offered within the posted salary range will be based upon work experience, skill level or knowledge.

Salaries are adjusted according to market in CA, NY Metro and Seattle.

Our Way of Working:

We’re proud to offer you flexibility. At Synchrony, our way of working allows you to have the option to work from home near one of our Hubs or come into one of our offices. You will be required to commute to your nearest Hub (either virtual or physical) for in-person engagement activities such as regular business or team meetings, training and culture events. 

 

*Field Sales and some Commercial team roles may have varied location requirements based upon partner obligations or preferences.

Eligibility Requirements:

  • You must be 18 years or older

  • You must have a high school diploma or equivalent

  • You must be willing to take a drug test, submit to a background investigation and submit fingerprints as part of the onboarding process

  • You must be able to satisfy the requirements of Section 19 of the Federal Deposit Insurance Act.

  • New hires (Level 4-7) must have 9 months of continuous service with the company before they are eligible to post on other roles.  Once this new hire time in position requirement is met, the associate will have a minimum 6 months’ time in position before they can post for future non-exempt roles.  Employees, level 8 or greater, must have at least 18 months’ time in position before they can post.  All internal employees must consistently meet performance expectations and have approval from your manager to post (or the approval of your manager and HR if you don’t meet the time in position or performance expectations).

Legal authorization to work in the U.S. is required.  We will not sponsor individuals for employment visas, now or in the future, for this job opening. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, disability, or veteran status. 

Our Commitment:

When you join us, you’ll be part of an inclusive culture where your individual skills, experience, and voice are not only heard – but valued. Together, we’re building a future where we can all belong, connect, and turn ideals into action. More than 50% of our workforce is engaged in our Employee Resource Groups (ERGs), where community and passion intersect to offer a safe space to learn and grow.

 

This starts when you choose to apply for a role at Synchrony. We ensure all qualified applicants will receive consideration for employment without regard to age, race, color, religion, gender, sexual orientation, gender identity, national origin, disability, or veteran status. We’re proud to have an award-winning culture for all. 

Reasonable Accommodation Notice:

  • Federal law requires employers to provide reasonable accommodation to qualified individuals with disabilities. Please tell us if you require a reasonable accommodation to apply for a job or to perform your job. Examples of reasonable accommodation include making a change to the application process or work procedures, providing documents in an alternate format, using a sign language interpreter, or using specialized equipment.

  • If you need special accommodations, please call our Career Support Line so that we can discuss your specific situation. We can be reached at 1-866-301-5627.   Representatives are available from 8am – 5pm Monday to Friday, Central Standard Time

Job Family Group:

Information Technology

This job is found at InterviewStack.io

Skills

analyticsawsredshiftsagemakerkafkahadoopsnowflakesoxapisdata modelingautomationci/cdmonitoringstorytellingrisk managementregulatory complianceroot cause analysisdata qualitydata architecture

About Synchrony Financial

Synchrony Financial is a consumer financial services company specializing in private label credit cards, promotional financing, and consumer installment loans. It partners with retailers, manufacturers, and healthcare providers to offer financing solutions. The company operates globally with a significant presence in the United States and India.

enterprise companyfinance, fintechpublicWebsite