InterviewStack.io LogoInterviewStack.io
Browse more Backend Developer jobs

Senior Back-End Engineer

Nabla

Paris office3 months ago
40 views17 saves7 applies

Prepare for this role


Benefits

Health Insurance

Job Type

full time

Description

About Nabla

We are a team of entrepreneurs, clinicians and engineers committed to bringing back joy to the practice of medicine.

Together with a community of clinician innovators, we’ve harnessed the best of machine learning science to develop Nabla: the leading AI assistant that’s restoring the human connection at the heart of healthcare. By streamlining clinical documentation, Nabla is helping clinicians focus on what matters most - patient care. Today, over 85,000 clinicians across 130+ healthcare organizations trust Nabla to support how they deliver care every day.

We’re at the start of an ambitious journey: Ambient listening, dictation, coding, and command capabilities are all converging into a proactive assistant that intuitively streamlines clinical and financial workflows.

Backed by a recent $70M Series C, we’re hiring to build the next generation of clinical AI and improve the lives of clinicians and patients everywhere.

This is a great time to join us!

The best of AI at the service of healthcare

Nabla’s phenomenal traction is the result of 3 years of diligent product development.

Led by former Meta AI Research engineers, our team has consistently anticipated how AI can revolutionize healthcare delivery. Our Machine Learning team continually leverages the latest advancements to unlock AI’s full potential in healthcare.

Yann LeCun, Meta’s Chief AI Scientist and Turing award winner, is an advisor to Nabla.

Engineering at Nabla

Engineering at Nabla is lean, fast-moving, and deeply technical. Our teams span machine learning, native desktop applications, and platform infrastructure to deliver AI into clinical settings reliably and at scale.

Your Team

At Nabla, product development is led jointly by Engineering and Product, and organized into cross-functional squads, each focused on a specific product area. Squads bring together product managers, designers, engineers of different profiles, and domain experts, and operate with a high level of ownership.
As a Senior Back-end Engineer, you’ll join one of these squads and contribute end to end to a specific part of the product.

What You'll Do

As a Senior Back-End Engineer, you will play a critical role in scaling Nabla’s AI-driven healthcare platform. You will take ownership of key components of our back-end systems, collaborate closely with product and machine learning teams, and help shape the technical direction of our infrastructure.

You will:

  • Design, build, and evolve our server-side applications and APIs

  • Lead complex integrations with external partners, especially Electronic Health Record (EHR) systems

  • Continuously improve and optimize our back-end architecture and developer experience

  • Guide architectural discussions and influence long-term technical decisions

  • Collaborate closely with Machine Learning, Product, and Front-End teams to deliver impactful end-to-end features

  • Mentor junior engineers and contribute to scaling the engineering culture

To give you a sense of the impact:

  • Nabla processes 10 billion tokens/month with LLMs

  • Every week, hundreds of thousands of clinical notes are automatically generated and synced with EHRs, saving thousands of hours for clinicians

  • Our APIs serve real-time workloads in high-stakes clinical environments

Your DNA

  • You have 5+ years of industry experience in back-end or full-stack engineering

  • You have strong foundations in computer science or a related discipline

  • You’re proficient in one or more widely used back-end languages (Java, Kotlin, C++, Python, etc.)

  • You have deep experience designing, building, and maintaining scalable APIs and distributed systems (GraphQL and OpenAPI experience is a plus)

  • You are comfortable driving architectural decisions and technical strategy

  • You write clean, maintainable code and have high standards for software quality

  • You communicate clearly in English

  • Bonus: experience with cloud infrastructure, security/compliance, or healthcare data standards (FHIR)

Our stack

  • Frontend: TypeScript, React, Tailwind CSS, Swift, Rust, Electron.

  • Backend: Kotlin / JVM, GraphQL, PostgreSQL.

  • ML & Infra: Python, PyTorch, Slurm, GCP, Terraform, Kubernetes.

Where you'll be based

Our offices are based in Paris 3e (Arts & Métiers). Remote policy: 1-2 days a week (with some flexibility). Possibility of working remotely 1-2 weeks once a year.

Benefits

Just like we’re dedicated to supporting doctors’ well-being, ensuring yours is a top priority. We firmly believe that by prioritizing your well-being, we support you to excel in your work.

Here are the benefits you get when joining Nabla:

  • Stock ownership

  • 100% healthcare coverage

  • Meal vouchers

  • Public transportation costs covered at 50%

  • Exercise class during the workday: Yoga, running, pilates, HIIT

  • Unlimited budget for book purchases, so you can continue to learn about ML / Healthcare

  • Culture of trust & accountability — your output matters more than your clock-in time

Life at Nabla

When you become a part of our company, you join a team of excellence-driven, curious, and genuinely kind individuals. Together, we're committed to making clinicians' lives easier and improving healthcare experiences for everyone. We believe in a world where clinicians can focus on what they were trained to do - caring for their patients, and where no patient feels their visit was rushed.

We come to work excited to leverage AI to do more for clinicians. We’re obsessed with our users’ satisfaction and we actively seek out opportunities to engage one-on-one with clinicians to understand how Nabla can better help. We consistently look for ways to improve and do not shy away from doing the work to excel. Whether it’s a feature our users asked for, or a new article for our blog, we prioritize collaboration to deliver exceptional outcomes.

We love having fun as much as we love work. Our #nablabla channel is as active as our #feature-show-off channel, we exercise during the work day at least 3 times a week (yoga, running, pilates, or HIIT, your choice!), enjoy regular off-sites to gather the team, and travel to see each other in places like NY, Paris, San Francisco, and many other vibrant cities. Oh, and we’re constantly snacking on chocolate or nuts!

If this sounds like an environment you’ll thrive in, we look forward to reading your application!

Our Values at Nabla

Joining Nabla means being part of a team that shares a commitment to excellence, humility, growth, and inclusion.

Every day is a new chance to excel

We aim for nothing less than the best and are willing to put in the effort and dedication required to exceed standards. We learn from yesterday’s failures and do better every day.

Stay humble

There’s no place for ego in our team. Our collective success is more important than individual achievements. We see humility as wisdom — keeping focus on the bigger picture.

Feedback is a gift

We embrace feedback and foster a culture of trust and respect that helps everyone grow. We communicate openly about both achievements and challenges, and we actively involve each other in finding solutions.

Committed to diversity

We recognize the ongoing challenge of diversity in tech. Our responsibility starts with fostering an inclusive environment where everyone feels empowered to be their authentic selves and do their best work.

Diversity & Inclusion

Diversity and inclusivity are fundamental values at Nabla. We embrace individuals from various backgrounds, including race, gender, educational history, sexual orientation, and beyond.

As an equal opportunity employer, we actively seek out and welcome applicants from diverse backgrounds, believing that a wide range of perspectives enriches our team and enhances our ability to innovate and thrive.

Avoid recruitment scams: Stay safe and informed

There is an active employment scam which is now using Nabla to collect personal information or financial scams. If you’re contacted by a Nabla recruiter, please ensure whomever is contacting you truly represents Nabla and is utilizing a nabla.com email address. We will never ask for the exchange of any money or credit card details during the recruitment process. Nabla utilizes a hiring platform for all applications; please be aware of any suspicious email activity from people who could be pretending to be recruiters or senior professionals at Nabla. You can find more information following this link.
Nabla does not accept unsolicited CVs from recruiters or employment agencies in response to the Nabla Careers page or a Nabla social media post. Any unsolicited CVs, including those submitted directly to hiring managers, are deemed to be the property of Nabla.

This job is found at InterviewStack.io

Skills

machine learningapisllmsjavakotlinc++pythondistributed systemsgraphqltypescriptreacttailwindcssswiftrustpytorchgcpterraformexcelpatient careclinical documentation

About Nabla

The most advanced AI Assistant, restoring the human connection at the heart of healthcare.

healthcare, softwareWebsite