InterviewStack.io LogoInterviewStack.io
Browse more Cybersecurity Engineer jobs

Information Systems Security Manager

100fb474-2541-4c2f-af57-30809a5118b9

Huntsville, Alabama, providing systems integration7 months ago
40 views23 saves6 applies

Prepare for this role


Job Type

full time

Description

WaveLink Overview:

WaveLink, Inc. (WLI) is an expanding, woman-owned small business based in Huntsville, Alabama, providing systems integration, aviation engineering, systems/software engineering, acquisition management, and cybersecurity expertise to the U.S. Army, Air Force, and Navy. WLI currently has a position available for:

Job Description:

WLI is seeking an ISSM with skilled expertise in the various aspects of U.S. Government information security. Expertise includes DISA STIG configuration, Scanning (SCAP & Nessus/ACAS), eMass, Windows Server/Workstation Access Control and Identity Management and their application to effective implementation of security measures to reduce risk. A key objective will be the assessment of existing security boundaries to identify alternative approaches and cyber tools to consolidate ATO management. Typical duties will range from conducting risk assessments and designing security solutions to creating and maintaining security policies and procedures. Ability to leverage multiple security technologies such as firewalls, intrusion detection systems, and active defense measures, in order to provide effective security for organization information infrastructure and government solutions. Must write well as a core job requirement.

Required Education and Experience:

  • Bachelor's degree in computer science, information systems or a related field is essential.
  • Minimum 5 years performing as a domain, system or network administrator.
  • Minimum 3 years performing information systems security engineering.
  • Minimum DoD Baseline Certifications for Level II: IAT / IAM / IASAE

Required Skills:

  • Design and implement security measures; monitor systems for signs of cyber attacks, and quickly respond to security incidents .
  • Conduct audits and risk assessments to reduce the likelihood of security breaches.
  • Apply U.S. Government Information Assurance (IA) requirements and prepare IA artifacts for TS/SCI, Secret, and SAP information systems. Ability to review and/or generate ATO’s, ISA’s, ATC’s, and IATT’s.
  • Solid understanding NIST controls and implementation of datacenter security operations including backup/COOP/auditing/scan requirements
  • Solid understanding of domain/server/workstation/storage and network security.

Clearance Level: Top Secret

Primary Location: Eglin AFB

WLI provides a comprehensive benefit package, with competitive salaries in a proactive, employee-oriented work environment.

WLI is an Equal Opportunity Employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex (including pregnancy, gender identity, and sexual orientation), national origin, age, disability, genetic information, or status as a protected veteran.

This job is found at InterviewStack.io

Skills

windows serverfirewallsiamtypescriptrisk assessmentnetwork securitysecurity operations