InterviewStack.io LogoInterviewStack.io
Browse more Information Security Analyst jobs

Junior Security Analyst - SECRET CLEARANCE REQUIRED

DirectViz Solutions

Herndon, VA, USA3 weeks ago
64 views25 saves2 applies

Prepare for this role


Benefits

Health InsurancePaid Time Off401kRetirement Plan

Job Type

full time

Description

DirectViz Solutions (DVS) is a dynamic and rapidly growing government contractor committed to delivering innovative IT solutions that address the mission-critical needs of our government clients. Through the expertise and dedication of our talented team, we provide cutting-edge technology services designed to achieve success and exceed expectations.

At DVS, we prioritize our employees as our greatest asset. We offer competitive compensation, comprehensive medical benefits, a 401(k) match, generous PTO accrual, professional development reimbursement, corporate-funded technology certifications, and robust employee recognition and appreciation programs.

Title: Junior Security Analyst

Location: Herndon, VA

Clearance: Active Secret or higher. REQUIRED

This position is from Sunday - Tuesday from 6:00 PM - 6AM or Thursday - Saturday from 6:00 PM - 6 AM and will rotate Wednesdays. Must be willing to work this shift.

DVS is looking for a Junior Security Analyst to join our growing team. The work location is onsite in Herndon, VA. Must have an active Secret clearance.

Key Responsibilities

  • Monitor and analyze security events and alerts reported by the TSA Security Information and Event Management (SIEM) system on a 24x7x365 basis.
  • Identify and investigate suspicious or malicious activity and cyber events that violate TSA policy.
  • Analyze logs and events from current and future device types that send data to the TSA Security Operations Center (SOC).
  • Review non-traditional data feeds (e.g., Human Resources data, badging information, physical security devices) integrated into the SIEM architecture.
  • Document all findings and additional information collected during each security investigation.
  • Record all relevant artifacts (e.g., emails, logs, documents, URLs, screenshots) associated with security events and incidents in the TSA SOC incident tracking system.

To support the 24x7x365 requirements of cyber operations there are four (2) available shift schedules:

  • Shift 1 - Sun, Mon, Tue - 6 PM to 6 AM
  • Shift 2 - Thu, Fri, Sat - 6 PM to 6 AM

The shifts will rotate personnel every other Wed to work 8 hours which will equal 80 hours over 2 weeks.

Required Qualifications:

Education: High School degree.

Experience:

  • 1 to 3 years of experience working in a Security Operations Center (SOC) or Network Operations Center (NOC) environment performing security event monitoring and analysis
  • Working knowledge of the various operating systems (e.g. Windows, OS X, Linux, etc.) commonly deployed in enterprise networks.
  • Must possess a working knowledge of network communications and routing protocols (e.g. TCP, UDP, ICMP, BGP, MPLS, etc.) and common internet applications and standards (e.g. SMTP, DNS, DHCP, SQL, HTTP, HTTPS, etc.)
  • Must be capable of analyzing security logs and events from the following types of devices such as, but not limited to: Firewalls (FWs), Intrusion Detection Sensors/Intrusion Prevention Sensors (IDS/IPS), Host-based Intrusion Detection System/ Host-based Intrusion Prevention System (HIDS/HIPS), proxy/web filter, vulnerability scans, routers, router Internet Protocol (IP) accounting systems (i.e., Cisco NetFlow), Virtual Private Network (VPN) gateways/concentrators, server event logs, e-mail and host anti-virus, desktop security monitoring agents, anti-virus servers, IP services (i.e. Domain Name System (DNS) Services, Dynamic Host Configuration Protocol (DHCP), network address translation devices, MDM (e.g. cellphones), Public Key Infrastructure (PKI), and cloud security infrastructure (e.g. Amazon Web Services (AWS), Azure, Oracle, Salesforce, etc.)
  • Clearance Requirements: Secret or higher.

Preferred Skills:

  • Certification: Security+, GIAC Security Essentials (GSEC) or equivalent certification is desired
  • Experience with Splunk query language
  • Experience with IDS/IPS/firewall/security configurations and signature development
  • Experience with PCAP analysis
  • Experience with Tanium threat response
  • Ability and prior experience with analyzing information technology security events to discern events that qualify as legitimate security incidents as opposed to non-incidents. This includes the identification of malicious code present within a computer system as well identification of malicious activities that are present within a computer system and/or enterprise network
  • Experience working with a ticket management system to collect, document and maintain information pertinent to security investigations and incidents
  • Excellent verbal and written communications skills and ability produce clear and thorough security incident reports and briefings
  • Experience in monitoring the operational status of monitoring components and escalating and reporting outages of the components
  • Conceptual understanding of Windows Active Directory is also desired
  • Experience working with various event logging systems and must be proficient in the review of security event log analysis. Previous experience with SIEM platforms that perform log collection, analysis, correlation, and alerting is also preferred
  • Experience with the identification and implementation of counter-measures or mitigating controls for deployment and implementation in the enterprise network environment
  • Experience in collecting and maintaining information pertinent to security; investigations and incidents in a format that supports analysis, situational awareness reporting, and law enforcement investigation efforts

Physical and Mental Qualifications:

  • Maintain focus and awareness throughout scheduled working hours.
  • Perform tasks requiring prolonged periods of sitting or standing at a desk, utilizing a computer, mouse, and keyboard.
  • Lift and move objects weighing up to 15 pounds as needed.
  • Exhibit excellent verbal and written communication skills, with a strong command of the English language.
  • Demonstrate the ability to work independently while also collaborating effectively as part of a team.
  • Quickly learn and retain routine tasks and processes.
  • Possess strong organizational skills, attention to detail, business correspondence proficiency, and self-management capabilities.
  • Perform the essential functions of the role satisfactorily; reasonable accommodation will be provided for employees with disabilities upon request.
  • Accept and adapt to additional responsibilities or changes to assigned duties as determined by DirectViz Solutions (DVS).

DirectViz Solutions, LLC (DVS) is an equal opportunity employer and prohibits discrimination and harassment against any employee or applicant for employment because of race, color, sex (including pregnancy), age, gender identity, creed, religion, national origin, sexual orientation, marital status, genetic information, disability, political affiliation, protected veteran status, or any other status protected by federal, state or local law.

DVS has a zero-tolerance policy for harassment, threats, coercion, discrimination, and intimidation. Employees may file a complaint or exercise any right protected by Executive Order 11246, Section 503 of the Rehabilitation Act of 1973, as amended, Section 4212 of the Vietnam Era Veterans Readjustment Assistance Act of 1974, or the Veterans Employment Opportunities Act of 1998.

This job is found at InterviewStack.io

Skills

siemmonitoringwindowslinuxbgpmplsdnsdhcpsqlfirewallsvpnawsazuresalesforcesplunkactive directorycloud securitysecurity operationslog analysis

About DirectViz Solutions

DirectViz Solutions delivers innovative, mission-focused technology solutions designed for the unique demands of defense and federal operations, specializing in cybersecurity, IT service management, and application development.

cybersecurity, it servicesWebsite