InterviewStack.io LogoInterviewStack.io
Browse more Software Engineer jobs

Senior Software Engineer II

Compass

Boston$176,000 - $196,1001 month ago
81 views25 saves9 applies

Prepare for this role


Benefits

EquityDental & VisionPaid Time OffParental Leave401kRetirement PlanStock OptionsWellness Program

Job Type

full time

Description

At Compass, our mission is to help everyone find their place in the world. Founded in 2012, we’re revolutionizing the real estate industry with our end-to-end platform that empowers residential real estate agents to deliver exceptional service to seller and buyer clients.

The Compass Integrated Services (CIS) engineering team is at the core of driving our next phase of growth and platform evolution. We empower agents and their clients to seamlessly manage the entire transaction journey by offering a complete suite of integrated homeownership services. By building a standardized, "one-click" workflow, our team provides the technology and operations that power strategic partnered services—including Title & Escrow, Home Warranty, Mortgage, and Insurance—across a broad national footprint.

Through the creation of this centralized and seamless technological ecosystem, we achieve powerful operational synergies. This work directly drives agent efficiency and deeper client loyalty, ultimately leading to strengthened platform adoption, enhanced customer retention, and increased per-transaction profitability for Compass.

At Compass, You Will:

  • Architect the Integrated Services Ecosystem: Lead the system design and technical architecture for the rollout of One-Click Title & Escrow, Insurance, Mortgage, and Home Warranty MVPs, ensuring solutions are scalable across existing and newly acquired markets.
  • Drive Cross-Domain Technical Strategy: Navigate complex data architecture challenges, such as defining data ingestion, mapping, and deduplication strategies between the Home Platform, Salesforce, and legacy data stores
  • Own End-to-End Delivery: Own features end-to-end, from technical design through implementation, deployment, monitoring, and production support.
  • Partner in Product Discovery: Collaborate closely with product managers and business stakeholders during the discovery phase of new initiatives. Translate complex requirements into clear technical blueprints and executable roadmaps.
  • Ensure System Reliability & Security: Act as the ultimate owner of the technical quality for the team's domain. Anticipate bottlenecks, evaluate technical tradeoffs, and ensure all partner integrations adhere to strict security and compliance standards
  • Act as a Technical Multiplier: Mentor engineers, lead design reviews, and establish engineering best practices. You will align your squad on technical direction while effectively resolving ambiguity in legacy migrations

What We Look For:

  • 7+ years of experience developing comprehensive, well-tested, and high-performance software applications with languages such as Go or Typescript
  • Experience with gRPC, Thrift, and other server-to-server communication protocols.
  • Experience with Kafka and event-driven systems
  • 3+ years using AWS / cloud technologies
  • High proficiency designing and implementing microservices that are well tested, fault tolerant, and scalable
  • Experience working across both modern and legacy frontend technologies — including frameworks such as Angular or React.
  • Strong analytical and systems-level debugging skills with the ability to reason through complex, interconnected systems
  • Comfort working across modern CI/CD tooling and collaborative Git-based workflows
  • Understanding and adherence to industry-standard best practices in software development and architecture
  • Practical experience using AI-assisted development tools in real delivery environments, including familiarity with tools like ClaudeCode and concepts such as CLAUDE.md project configuration and custom skills
  • BS in Computer Science or equivalent practical experience

Compensation: The base pay range for this position is $176,000-$196,100; however, base pay offered may vary depending on job-related knowledge, skills, and experience. Bonuses and restricted stock units may be provided as part of the compensation package, in addition to a full range of benefits. Base pay is based on market location. Minimum wage for the position will always be met.

Perks that You Need to Know About:

Participation in our incentive programs (which may include eligible cash, equity, or commissions). Plus paid vacation, holidays, sick time, parental leave, and recharge leave; medical, tele-health, dental and vision benefits; 401(k) plan; flexible spending accounts (FSAs); commuter program; life and disability insurance; Maven (a support system for new parents); Carrot (fertility benefits); UrbanSitter (caregiver referral network); Employee Assistance Program; and pet insurance.

Do your best work, be your authentic self.
At Compass, we believe that everyone deserves to find their place in the world — a place where they feel like they belong, where they can be their authentic selves, where they can thrive. Our collaborative, energetic culture is grounded in our Compass Entrepreneurship Principles and our commitment to diversity, equity, inclusion, growth and mobility. As an equal opportunity employer, we offer competitive compensation packages, robust benefits and professional growth opportunities aimed at helping to improve our employees' lives and careers.

Notice for California Applicants

Los Angeles County Fair Chance Notice

This job is found at InterviewStack.io

Skills

system designsalesforcemonitoringtypescriptgrpckafkaawsmicroservicesangulardebuggingci/cdproduct discoverycustomer retentiondata architecturedata ingestion

About Compass

Buy, sell, and rent smarter with Compass. Partner with a local real estate agent to find the home or apartment that’s right for you.

real estate, technologyWebsite