InterviewStack.io LogoInterviewStack.io
Browse more Software Engineer jobs

Staff Software Engineer

Anduril Industries

Atlanta, Georgia, United States$190,000 - $252,0004 weeks ago
27 views7 saves3 applies

Prepare for this role


Benefits

Equity

Job Type

full time

Description

Anduril Industries is a defense technology company with a mission to transform U.S. and allied military capabilities with advanced technology. By bringing the expertise, technology, and business model of the 21st century’s most innovative companies to the defense industry, Anduril is changing how military systems are designed, built and sold. Anduril’s family of systems is powered by Lattice OS, an AI-powered operating system that turns thousands of data streams into a realtime, 3D command and control center. As the world enters an era of strategic competition, Anduril is committed to bringing cutting-edge autonomy, AI, computer vision, sensor fusion, and networking technology to the military in months, not years.

ABOUT THE TEAM:

ArsenalOS is the digital backbone of Anduril’s hardware enterprise. It connects the full lifecycle, from concept to build to field feedback, into one operating environment built for speed, traceability, autonomy, and continuous improvement. That environment includes not just the software used to design, plan, and execute work, but also the factory-facing infrastructure that connects operators, machines, test systems, and OT networks into the same adaptive Build Chain. It is not a support function, but rather a strategic investment by Anduril that the operating system of the hardware lifecycle is how we win. It will be one of the mechanisms by which Anduril out-builds, out-adapts, and out-scales the traditional defense industrial base.

ABOUT THE JOB:

We are looking for a Staff Software Engineer to join our QualityOS team within Forge MES (Manufacturing Execution System). As a Staff Engineer, you will set the technical direction and architectural standards. You'll architect and implement mission-critical distributed systems that scale Anduril's manufacturing operations while maintaining the technical bar for reliability, performance, and maintainability.
Your impact will span beyond the immediate team. You'll serve as a technical bridge between the QualityOS product team and our Platform/Foundations organization, ensuring we build on solid infrastructure while influencing platform capabilities to meet manufacturing needs. You'll represent the quality domain in broader MES architectural decisions, contributing to technical strategy that affects multiple product teams.
We're looking for someone who combines deep technical expertise with strong collaborative instincts—someone who can dive into complex distributed systems, establish patterns that others follow, and drive consensus across engineering teams. You'll balance hands-on technical execution on critical features with raising the technical standards of the team through architecture reviews, code quality, and operational excellence. Your decisions will have lasting impact on how Anduril scales manufacturing quality systems into a next-generation defense company.

WHAT YOU'LL DO

Technical Architecture & Execution:

  • Define and drive technical architecture for QualityOS - make decisions on system design, scalability patterns, integration strategies, and platform vs. build tradeoffs that shape team execution
  • Architect and implement complex distributed systems - build mission-critical services, APIs, and tooling that enable safe, fast delivery across manufacturing quality workflows
  • Lead by example with engineering excellence - establish patterns through hands-on work: comprehensive testing, deployment safety (blue/green/canary), infrastructure as code, observability, and operational rigor

Cross-Team Influence & Collaboration:

  • Bridge product and platform teams - collaborate with Platform/Foundations to shape shared infrastructure based on QualityOS needs while driving adoption of platform capabilities
  • Partner across MES product teams - integrate QualityOS into cohesive manufacturing experiences, evolve data models across quality/production domains, and drive technical consensus on cross-cutting concerns
  • Represent quality domain technically - work with architecture, security, operations, and infrastructure teams to ensure quality requirements influence broader technical decisions

Team & Technical Standards:

  • Raise the technical bar for the team - through rigorous code review, architecture discussions, establishing shared ownership models, and improving practices that balance velocity with correctness
  • Remove friction and unblock execution - identify systemic technical issues, eliminate single points of failure, and create leverage through automation and improved tooling

REQUIRED QUALIFICATIONS

  • 12+ years of experience in a software engineering role building products in fast-paced environments
  • Proven ability to influence technical direction across teams - drive architectural consensus, build alignment, and lead technical initiatives beyond a single team
  • Experience working with large enterprise applications and platforms with high availability requirements
  • Strong full-stack capabilities with expertise in modern web technologies - JavaScript/TypeScript, React, and web frameworks (Next.js, Remix, etc.)
  • User-focused engineering mindset - ability to translate user needs into technical solutions while balancing user experience with engineering constraints
  • Excellent communication skills, able to influence stakeholders, translate ambiguous requirements and build cross-team alignment.
  • U.S. Person status is required as this position needs to access export controlled data

PREFERRED QUALIFICATIONS

    • We encourage people from all backgrounds to apply but our tech stack uses AWS, Typescript, and React/Remix so familiarity with all of these tools will be particularly helpful
    • Experience in hyper growth startup-like environments. Demonstrated successes in scaling and maturing software development processes, team culture and methods, and ability to balance short-term and long-term trade offs
    • Manufacturing/quality domain knowledge - experience with quality management systems (QMS), manufacturing execution systems (MES), or incident management platforms
    • Experience in defense, autonomy, robotics, or mission-critical systems (helpful but not required)
    • Experience with AI/LLM integration - leveraging state-of-the-art models and agentic tooling in production software development
    • Eligible to obtain and maintain a U.S. TS/SCI clearance

US Salary Range
$190,000$252,000 USD

The salary range for this role is an estimate based on a wide range of compensation factors, inclusive of base salary only. Actual salary offer may vary based on (but not limited to) work experience, education and/or training, critical skills, and/or business considerations. Highly competitive equity grants are included in the majority of full time offers; and are considered part of Anduril's total compensation package. Additionally, Anduril offers top-tier benefits for full-time employees, including:

Benefits

At Anduril, we invest in our people. Our comprehensive, competitive benefits package (available at little to no cost to employees) ensures you’re supported in health, recovery, and whatever comes next. For more information, Explore Our Benefits.

Protecting Yourself from Recruitment Scams

Anduril is committed to maintaining the integrity of our Talent acquisition process and the security of our candidates. We've observed a rise in sophisticated phishing and fraudulent schemes where individuals impersonate Anduril representatives, luring job seekers with false interviews or job offers. These scammers often attempt to extract payment or sensitive personal information.

To ensure your safety and help you navigate your job search with confidence, please keep the following critical points in mind:

  • No Financial Requests: Anduril will never solicit payment or demand personal financial details (such as banking information, credit card numbers, or social security numbers) at any stage of our hiring process. Our legitimate recruitment is entirely free for candidates.

  • Please always verify communications:
    • Direct from Anduril: If you receive an email from one of our recruiters, it will only come from an @anduril.com address.
    • Via Agency Partner: If contacted by a recruiting agency for an Anduril role, their email will clearly identify their agency. If you suspect any suspicious activity, please verify the agency's authenticity by reaching out to contact@anduril.com.
  • Exercise Caution with Unsolicited Outreach: If you receive any communication that appears suspicious, contains grammatical errors, or makes unusual requests, do not engage. Always confirm the sender's email domain is @anduril.com before providing any personal information or clicking on links.

  • What to Do If You Suspect Fraud: Should you encounter any questionable or fraudulent outreach claiming to be from Anduril, please report it immediately to contact@anduril.com. Your proactive caution is invaluable in protecting your personal information and upholding the security and trustworthiness of our recruitment efforts.

Data Privacy

To view Anduril's candidate data privacy policy, please visit https://anduril.com/applicant-privacy-notice/.

By submitting your application, you consent to Anduril Industries using a third-party service provider to conduct pre-employment risk, integrity, and due diligence screening and assessing potential risks as part of your application process. This third-party service provider provides risk-intelligence services that may include analysis of sanctions and watchlists, adverse media, public-record information, and other lawful open-source or commercial data sources. This third-party service provider does not act as a consumer reporting agency. Use of this provider helps to ensure compliance with applicable laws and protect technology, intellectual property, and organizational security.

This job is found at InterviewStack.io

Skills

next.jscomputer visiondistributed systemssystem designscalabilityapisinfrastructure as codeobservabilityautomationjavascripttypescriptreactawsllmuser experiencedue diligencequality managementintellectual propertydata privacytalent acquisitionincident managementcode reviewhigh availability

About Anduril Industries

Anduril Industries is a defense technology company specializing in advanced hardware and software solutions for national security. The company develops autonomous systems, AI-powered surveillance, and defense infrastructure to enhance military capabilities.

large companydefense, technologyseries_dWebsite