InterviewStack.io LogoInterviewStack.io
Browse more Data Engineer jobs

Data Engineer / EF / São Jose dos Campos/SP

Bayer

São José dos Campos,São Paulo,Brazil3 weeks ago
10 views2 saves1 applies

Prepare for this role


Benefits

Remote WorkDental & VisionParental LeaveRetirement Plan

Job Type

full time

Description

 

 

Data Engineer / EF / São Jose dos Campos/SP 

 
  
  

Our mission – Health for all, Hunger for none – is at the heart of everything we do.
Now, imagine a workplace where your voice truly matters. A place where you're invited to take part in decisions, where your unique skills and knowledge guide the projects you join. Here, leaders are more than managers – they’re mentors and coaches, walking alongside you. And with innovation and planning cycles as quick as 90 days, we’re always moving forward, together.

With our new way of working, called Dynamic Shared Ownership (DSO), we’re building a more agile, less bureaucratic organization – one that’s focused on creating real value for everyone: farmers, patients, consumers, employees, investors, and society as a whole.

At Bayer, Diversity and Inclusion aren’t just buzzwords – they’re core values we live by every day. We believe that when people from different backgrounds come together, amazing things happen. Diverse teams spark creativity, drive innovation, and make our workplace more welcoming for everyone.

If you’re someone who wants to shape your own path, who values creativity and brings a spirit of innovation – you’ll feel right at home here. Come be part of this journey. Be yourself. We are Bayer.

 

GET TO KNOW OUR AREA:

We are GBS – Global Business Services, Bayer's shared services center, located in São José dos Campos/SP. GBS acts as a global strategic hub, supporting different areas of the company.

At this position you will be part of a Digital hub in GBS supporting R&D functions as Regulatory Science, Discovery and Testing for our Crop Protection business. Currently, there are seven open positions for this role.

The primary responsibilities of Data Engineers include extracting, loading, and transforming data sets from various source systems. This role involves creating and maintaining data pipelines for ingesting data into storage solutions (such as data lakes and warehouses) within a structured framework that encompasses staging, core, and mart layers.

The goal is to maximize the value of the data generated within the R&D and Regulatory landscape.

Data extraction will involve both internal and external data sets, necessitating cloud enabled solutions. The data engineer will function as an individual contributor while collaborating with other global data engineers to ensure consistent processes for maintaining our digital environment.

Additionally, the data engineer will work closely with other digital teams to guarantee that data is readily available for use in data analytics, data visualizations, machine learning, business intelligence, and data simulations.

GBS has a global and collaborative scope, offering development opportunities and allowing a broad view of processes and interaction with different areas and sites of Bayer.

 

YOUR MISSION WILL BE TO:

Data Engineering and Pipeline Designing

  • Implement, and operate batch and streaming data pipelines using technologies such as Kafka, Flink/Spark Streaming, cloud ETL/ELT services, and serverless architectures to ingest, transform, and curate data from instruments, field systems, LIMS, and external partners into cloud data platforms and domain data products.
  • Create and maintain data pipelines for data ingestion into storage solutions (data lakes and warehouses; Agentic AI/ML) across staging, core, and mart layers.
  • Ensure data quality by adhering to data governance practices, including master/reference data management and data security.
  • Collaborate with digital teams to ensure data availability for analytics, visualizations, machine learning, and business intelligence using DevOps & DataOps methodology.
  • Implement data solutions according to design documentation using AWS and GCP cloud services, Kafka, SQL and NoSQL databases, and languages such as Python, following agile methods and software engineering best practices (version control (GitHub), code review, automated testing, CI/CD, Infrastructure--as--Code).

Collaboration & Learning

  • Work closely with data scientists, data engineers, and information management teams to support data needs, availability and usability.
  • Participate in discussions to understand data requirements from Product Managers, Data Stewards, scientists, bioinformaticians and business stakeholders and R&D stakeholders
  • Work as a full member of agile teams, participating in planning, daily stand-ups, reviews, retrospectives, and cross team- coordination (e.g., peer programming, retrospectives, architecture reviews) to align roadmaps, dependencies, and priorities
  • Actively seek feedback and guidance to accelerate technical and professional growth

Standards, Documentation & Continuous Improvement

  • Follow established engineering standards, coding guidelines, and documentation practices
  • Contribute code, configurations, and documentation to shared repositories
  • Participate in code reviews, testing activities, and retrospectives as a learner and contributor
  • Stay current with foundational data engineering concepts, tools, and best practices

 

ARE YOU READY FOR THE POSITION?

Education & Experience

  • Bachelor’s (or Technology degree) in Computer/Software Engineering, Information Systems or related.
  • Experience in data engineering / data pipelining. 
  • Postgraduate certificate in Data Engineering/Big Data/Data Architecture is a plus.
  • Certifications: BigQuery/Azure Synapse/Redshift; Airflow/dbt; AWS/GCP/Azure data is a plus
  • Insights in Machine Learning & ModelOps is a plus
  • Availability to work on-site one (1) day per week in São Jose dos Campos/SP - GBS site

Languages

  • Advanced / Fluent English

Technical knowledge and/or experience: 

  • Proficiency with cloud platforms (GCP, AWS, Azure) and their storage solutions (GCS, S3, Azure Blob Storage).
  • Experience with serverless computing (Google Cloud Functions, AWS Lambda, Azure Functions).
  • Strong knowledge of SQL and NoSQL databases, especially Google BigQuery.
  • Familiarity with Big Data tools (Spark, Kafka, Flink, Hadoop).
  • Proficient in Python for data manipulation and analysis.
  • Familiarity with workflow/pipeline tools (Airflow, AWS Step Functions, KubeFlow).
  • Experience with container orchestration tools (Docker) and version control (GitHub).
  • Experience working in cross-functional or matrixed environments.
  • Ability to independently translate business or scientific questions into analytical solutions
  • Strong problem-solving and analytical thinking skills
  • Effective communication with both technical and non-technical audience
  • Knowledge in Data Governance practices is a plus
  • Experience with data visualization tools (PowerBI, Spotfire) is a plus.
  • Ability to manage multiple tasks and deliver results with limited supervision
  • Engineering & MLOps fundamentals: version control, reproducibility; basic model lifecycle management including monitoring, maintenance, and continuous improvement of ML/AI solutions in production environments is desirable
  • Machine Learning & Analytics: knowledge about supervised and unsupervised learning, practical experience implementation of ML approaches, Model evaluation & validation, Feature engineering, Understanding of ML limitation & data leakage is desirable

 

What else you’ll find here:

At Bayer, we care deeply about the well-being of our people. That’s why our benefits are built around three essential pillars: integrated health, financial well-being, and life balance. Together, they support a healthier, more fulfilling life – inside and outside of work.

Here’s a glimpse of what we offer:

  • Encouragement for a healthy lifestyle
  • Support in identifying and monitoring physical and mental health risks
  • Initiatives focused on health promotion, prevention, and care
  • Real balance between personal and professional life
  • Guidance for personal financial planning
  • Insurance and private pension plans to help you build a secure future

And of course, we also offer a full range of market-standard benefits, including medical and dental care, life insurance, meal benefits, Wellhub (formerly Gympass) and TotalPass.

What makes us different:

  • Flexible/hybrid work model*
  • Short Fridays and extended holiday breaks*
  • Flexible vacation planning (within legal guidelines)
  • Language courses – Free access to standard courses through our partner Education First (EF), in multiple languages like English, Spanish, German, French, Portuguese, and Swedish
  • Pharmacy subsidy – 50% discount on Bayer over-the-counter products, and full coverage for prescription Bayer medications
  • Conte Comigo – A support program offering psychological assistance, help with substance dependency, and legal and financial counseling
  • Bem Nascer – A special package of exclusive benefits for new parents
  • Childcare assistance – Additional support for parents welcoming a new child
  • Parental leave – A benefit designed to strengthen family bonds, offering equal opportunities for all parents, regardless of gender identity or family structure
  • Private pension plan – A long-term savings plan with a 200% company match on your contributions
  • Unico Skill: an educational hub offering 26,000+ courses from 90+ renowned institutions, including undergraduate and graduate programs, MBAs, short courses, mentoring, and language classes.

 

 

 

*Benefits may vary depending on your role and location.

 

 

 

 

 

  
Período disponível para candidatura:De 22/06/2026 a 03/07/2026Referência:872634   
Divisão:Crop Science  Local:Brasil : São Paulo : São José dos Campos   
Área Funcional:Tecnologia da Informação  Nível da Posição:VS 1.1   
Grupo de Contratação:Regular Horário de Trabalho:Administrativo 
 
 
 
 
   
   
   
 
 

This job is found at InterviewStack.io

Skills

entity frameworkagilesparkdata pipelinesanalyticsmachine learningkafkaflinketlawsgcpsqlnosqlpythonci/cdbigqueryazureredshiftairflowdbts3lambdahadoopkubeflowdockerdata visualizationpower bimlopsmonitoringfinancial planningdata governancedata qualitymodel evaluationfeature engineeringbusiness intelligencecode reviewautomated testingdata architecturedata ingestion