Senior Machine Learning Engineer
Blue J
Ontario, CanadaRemote$140,000+3 months ago
54 views28 saves3 applies
Prepare for this role
Benefits
Remote Work
Job Type
full time
Description
About Blue J
Blue J’s ambition is to be the world leader in generative AI for tax experts. Our AI tax research software is widely regarded as the best in the market. We are racing ahead with an exciting product development roadmap to continue to delight our customers and to ensure that our users can generate the very best possible tax research answers in the service of their clients in record time.
Our company is at the forefront of applying artificial intelligence to tax research. We recently announced our $122M USD Series D raise, to accelerate innovation and deliver even greater value to tax professionals. Since launching our flagship generative AI product, we have blown past our revenue targets quarter over quarter.
We're now looking for a skilled Senior Machine Learning Engineer who thrives in a fast-paced environment and is passionate about shaping the future of AI-assisted tax research.Your work will directly advance our product and AI capabilities, keeping our technology at the leading edge.
About The Team
Our Data Science and AI team is made up of curious, creative people who love solving tough problems. Much of our work focuses on Generative AI, where we design and optimize retrieval-augmented generation (RAG) pipelines that bring intelligence and precision to complex domains like tax and legal analysis. Whether it’s improving model performance, enhancing retrieval quality, or applying the latest research in large language models, we’re always looking for opportunities to make our AI better.
We care deeply about both quality and speed. Strong engineering practices help us move quickly and confidently, and we do. Our models and data pipelines are updated and deployed regularly, allowing us to learn fast and continuously improve.
We share knowledge through lunch-and-learns, collaborative brainstorms, and tight partnership with Product and Engineering to turn ideas into measurable impact.
A Note on Location
We are excited to meet with qualified candidates and are grateful for everyone’s interest, however this is a hybrid position that requires applicants to be within driving distance of Toronto for 1-2 in person meetings a quarter. All candidates must be eligible to work in Canada.
About the Role
As a Senior Machine Learning Engineer, you’ll help shape the next generation of intelligent features and systems that power our products. You’ll work closely with data scientists, and software engineers to design, build, and deploy scalable RAG solutions, from training models to developing production-ready pipelines for the domain of tax and legal research.
This role is a great fit for someone who’s curious about data and eager to turn insights into real-world impact. You’ll also support other team members through mentorship, sharing what you know, and collaboration to grow our machine learning practice.
What You'll be Doing
- Designing, developing, and deploying end-to-end machine learning systems from data processing and prompt engineering to model evaluation, and production deployment
- Writing high-quality, well-tested ML code, while mentoring other engineers and data scientists to deliver impactful, production-ready solutions
- Collaborating with data science and engineering to bring state-of-the-art ML techniques including deep learning, NLP, and generative AI into real-world tax applications
- Sharing knowledge, reviewing code and experiments, and helping improve our ML engineering standards, tooling, and best practices
- Staying on top of industry and technology trends, exploring new ideas and innovations to bring into your work
What You Offer Us
- 8+ years of hands-on experience in machine learning engineering, with a strong background in Python
- Solid understanding of machine learning fundamentals, data structures, and algorithms, with experience deploying ML models into production environments
- Hands-on experience with Retrieval-Augmented Generation (RAG) and agentic AI, such as implementing end-to-end pipelines and understanding core components
- Proven experience leading technical projects or teams, ideally involving ML systems or data products
- Strong communication skills, you can explain complex technical ideas clearly and collaborate effectively across teams
- A growth mindset, you bring curiosity, rigor, and a desire to keep learning and improving both your craft and the systems you work on
Technologies You Can Expect to Work With
- Languages & Frameworks: Python / TypeScript / Node.js
- ML & Data Tools: PyTorch / TensorFlow / scikit-learn / LangChain / Hugging Face / Proprietary and Open Source LLMs/ Agents SDK/ADK
- Data Infrastructure: Apache Kafka / PostgreSQL / Pinecone / Elasticsearch
- MLOps & DevOps: Kubernetes / AWS / Docker / DataDog / MLflow
A Bit About Us
- We’re well-funded and offer competitive base salaries and stock options. You’ll play a crucial role in our growth, and it’s important to us that you share in our long-term success.
- We are taking an exciting, highly anticipated new product into a virtually untapped market at a time when there is a huge amount of buzz around the type of work that we do. You’ll have the opportunity to work at our growing organization, and play a meaningful role in our expansion.
- We've got great leadership and you'll get to work with and learn from team leaders with a proven track record of success in the technology industry.
- We’ve got an amazing team. We’re mission-driven and motivated by success, but we’re friendly, we’re collaborative, and we care about each other. We’ve got all the start-up perks you’d expect, and are intentionally building a culture where you can pickleball if you want, feel safe to be yourself at work, and watch your career grow because your team has invested in you.
- We care about you. You’ll have a healthy work/life balance and colleagues who respect it. We’ve mindfully put together a great benefits package that covers you and your whole family.
The Core Values That Define Our Culture
- We are customer-focused
- We put the team interest before self-interest
- We are pleasant and playful
- We are open to better ideas
- We deliver on our promises
- We solve the tough problems
What to Expect in the Interview Process
We’re expecting strong interest in this role and are looking forward to growing our team! A human will review every application and we’ll get back to all candidates within 10 days of submission. Thanks for your patience, we look forward to connecting!
Interview Process
- Chat with Dan, Talent Acquisition Manager
- Meet Soumali, Director of AI
- Technical exercises with our engineering team
- Coding
- System design
- Get to know our engineering leadership team
- Meet Ben, our CEO
We believe our strength is built on diversity of thought, and encourage candidates from all backgrounds and experiences to apply. We value inclusiveness and are an equal opportunity employer. We do not discriminate based on race, religion, colour, national origin, gender, sexual orientation, age, marital status, veteran status, or disability status.
We strive to create an inclusive and accessible hiring experience for all candidates. If you need any accommodations during the interview process, please let us know in your application. Our team is dedicated to providing the necessary support and making reasonable adjustments to ensure a smooth process for everyone.
Compensation
The base pay range for this role is CA$140,000 – CA$180,000 per year.
Final compensation will be set fairly and thoughtfully based on experience, expertise, and alignment with the role’s responsibilities. While all candidates are expected to bring directly relevant experience, the top of the range is typically reserved for individuals who demonstrate exceptional depth in the role’s core competencies, a strong track record of impact in similar environments, and the ability to operate with a high degree of autonomy from day one.
This job is found at InterviewStack.io
Skills
generative aimachine learningragdata pipelinesdeep learningnlppythonalgorithmstypescriptnode.jspytorchtensorflowscikit-learnlangchainllmsapachekafkapostgresqlelasticsearchmlopskubernetesawsdockerdatadogmlflowsystem designlegal researchtalent acquisitiondata sciencemodel evaluationlarge language modelsprompt engineeringdata structures
About Blue J
Blue J is the leading generative AI solution for tax research. Trusted by firms of all sizes, Blue J delivers fast, verifiable answers to complex tax questions, empowering professionals to provide exceptional client service.