InterviewStack.io LogoInterviewStack.io
Browse more Data Engineer jobs

Senior Data Architect

Oura Health

Hybrid - San Francisco, California2 months ago
67 views34 saves0 applies

Prepare for this role


Benefits

EquityHealth InsuranceDental & VisionPaid Time OffParental LeaveWellness Program

Job Type

full time

Description

Our mission at Oura is to empower every person to own their inner potential. Our award-winning products help our global community gain a deeper knowledge of their readiness, activity, and sleep quality by using their Oura Ring and its connected app. We've helped millions of people understand and improve their health by providing daily insights and practical steps to inspire healthy lifestyles.

Empowering the world starts with living our values and empowering our team. As a quickly growing company focused on helping people live healthier and happier lives, we ensure that our team members have what they need to do their best work — both in and out of the office.

About the Role

We are seeking an experienced Senior Data Architect as part of our unified data mesh platform. Reporting to the Sr. Director of Data Management, this role will be responsible for setting the data foundations and models for our Data Products to accelerate our business growth, deepen our product and membership understanding, and optimize our business operations.

We are looking for a Data Architect/Modeler with deep expertise in modern cloud architectures and the Data Mesh approach. You will be responsible for designing the structural foundations of our data products, ensuring they are interoperable, scalable, and trustworthy. You will bridge the gap between complex business requirements and high-performance technical design, acting as the primary blueprint designer for our global data lifecycle.

What You Will Do

  • Architect & Model: Design and manage data domains to enable the creation of interoperable, trustworthy data products.
  • Cloud Infrastructure: Build and optimize Oura’s Data Lakehouse leveraging Databricks, Google Big Query, and Snowflake to process Terabyte-Petabyte scale data.
  • Data Mesh Governance: Implement federated data governance within the data mesh to ensure processes meet privacy, compliance (HIPAA/PHI), and security requirements.
  • Collaborate: Partner with Data Engineering, Data Science, and Business Domain owners to advocate for unified analytics and modeling best practices.
  • AI Readiness: Design vector-based data architectures and Retrieval Augmented Generation (RAG) patterns to enable LLM reporting and Agentic AI.
  • Standardization: Establish scalable data management frameworks and a governed data dictionary to enable organizational self-service.

What You Have

Experience: 8+ years of experience in data architecture or modeling, with a strong technical foundation in cloud-based platforms (AWS, GCP, Databricks or Azure).

Based on the provided job description and industry standards for modern data ecosystems, the following skillsets are required for a Data Architect focusing on Data Lakes, Enterprise Data Warehouses (EDW), and Advanced Analytics:

Cloud Platform & Infrastructure Mastery

  • Multi-Cloud Expertise: Hands-on expertise in major cloud platforms including AWS (S3, Kinesis, Glue, Athena), GCP (BigQuery, VertexAI), or Azure.
  • Modern Data Warehousing: Proficiency in designing and managing cloud-native warehouses like Snowflake or Google BigQuery.
  • Lakehouse Architecture: Ability to build and operate a Unified Global Lakehouse that merges the flexibility of a data lake with the management of a warehouse.
  • Containerization & Workflows: Experience with Docker, Pulumi and various workflow engines to manage complex data processing tasks.

Data Modeling & Strategy

  • Data Mesh Principles: Familiarity with the Data Mesh approach, specifically managing federated data governance and decentralized data ownership.
  • Lifecycle Management: Capability to lead the entire data lifecycle, from initial data definition to final delivery and consumption.
  • Standardization: Expertise in Master Data Management (MDM) and Reference Data Management (RDM) to ensure consistency across the enterprise.
  • Schema Design: Proficiency in using modern formats like Iceberg and transformation tools like dbt to maintain high-quality data structures including dbt Cloud on Databricks for SQL-based modeling (bronze/silver/gold)

Advanced Analytics & AI Readiness

  • AI/ML Integration: Experience with production-quality AI/ML and predictive modeling, leveraging platforms like VertexAI and MLOps frameworks.
  • LLM & NLP Design: Skill in designing architectures for Large Language Models (LLM) using Retrieval Augmented Generation (RAG) and vector-based data designs.
  • Automated Insights: Ability to design systems for predictive analytics, anomaly detection, and automated reporting.
  • Agentic AI: Familiarity with Agentic AI to deliver interactive, intelligent dashboards and self-serve capabilities.

Governance, Security & Compliance

  • Data Residency: Knowledge of global data residency requirements and privacy standards.
  • Regulatory Standards: Expertise in establishing HIPAA and PHI (Protected Health Information) standards within regulated environments.
  • Quality Assurance: Championing best practices for data accuracy, reliability, and trustworthiness through rigorous validation and peer review.

Technical Foundations & Tools

  • Programming & Processing: Broad knowledge of software fundamentals and stream processing using Kafka, Kinesis, Python, Spark and SQL.
  • Integration/Integration: Expertise in integrating diverse data sources, including transactional, product, and compliance data into a centralized function using tools such as dbt, fivetran
  • Orchestration: job and task automation and scheduler design using tools such as Airflow, Dagster, dbt, Databricks Lakeflow
  • Observability: Design for high availability and performance bottlenecks including long running high cost tasks.
  • Distributed processing: Spark (via Databricks) for large-scale ETL/ML.

Nice to Have

  • Experience in the healthcare, wellness, consumer electronics, wearables, digital health, or subscription services industries.
  • Broad knowledge of software fundamentals, databases, warehouses, and system design with experience on various programming languages
  • Experience streamlining multiple data pipelines into a centralized function that allows effective and efficient oversight of business processes and product development; expertise in integrating diverse data sources, including product, transactional, and compliance data
  • Embedded analytics into product, finance, sales, marketing, business operations, and customer experience
  • Ability to navigate hypergrowth while managing regulatory constraints
  • Strong technical foundation, demonstrated through education or early-career hands-on roles
  • Experience with production-quality AI/ML, predictive modeling, and leveraging analytics tools like VertexAI, MLOps, MLFlow, dbt, Microstrategy, Tableau, and Power BI, Thoughtspot
  • Experience leading the development of a robust and scalable data platform that can support the organization’s growing data needs with cost tiering
  • Advanced degree in Engineering, Data Science, Statistics, Computer Science, or a related field is preferred

Benefits

At Oura, we care about you and your well-being. Everyone here at Oura has a ring of their own and we are continually looking to improve employee health.

What we offer:

  • Competitive salary and equity packages
  • Health, dental, vision insurance, and mental health resources
  • An Oura Ring of your own plus employee discounts for friends & family
  • 20 days of paid time off plus 13 paid holidays plus 8 days of flexible wellness time off
  • Paid sick leave and parental leave

Oura takes a market-based approach to pay, which may vary depending on your location. US locations are categorized into tiers based on a cost of labor index for that geographic area. While most offers will be closer to the starting range, successful candidates' pay will be determined based on job-related skills, experience, qualifications, work location, internal peer equity, and market conditions. These ranges may be modified in the future.

  • Region 1 $172,550 - $203,000

A recruiter can determine your zones/tiers based on your US location.

We are not considering candidates residing in the following states: Alaska (AK), Delaware (DE), Iowa (IA), Mississippi (MS), Missouri (MO), Nebraska (NE), South Dakota (SD), West Virginia (WV), and Wisconsin (WI)

Oura is proud to be an equal opportunity workplace. We celebrate diversity and are committed to creating an inclusive environment for all employees. Individuals seeking employment at Oura are considered without regard to age, ancestry, color, gender (including pregnancy, childbirth, or related medical conditions), gender identity or expression, genetic information, marital status, medical condition, mental or physical disability, national origin, protected family care or medical leave status, race, religion (including beliefs and practices or the absence thereof), sexual orientation, military or veteran status, or any other characteristic protected by federal, state, or local laws. We will not tolerate discrimination or harassment based on any of these characteristics.

We will work to ensure individuals with disabilities are provided reasonable accommodation to participate in the interview process, to perform essential job functions, and to receive other benefits and privileges of employment.

Disclaimer: Beware of fake job offers!
We’ve been alerted to scammers posing as ŌURA recruiters, especially for remote roles. Please note:

  • Our jobs are listed only on the ŌURA Careers page and trusted job boards.
  • We will never ask for personal information like ID or payment for equipment upfront.
  • Official offers are sent through Docusign after a verbal offer, not via text or email.

Stay cautious and protect your personal details.

To all recruitment agencies: Oura does not accept agency resumes. Please do not forward resumes to our jobs alias, Oura employees, or any other organization's location. Oura is not responsible for any fees related to unsolicited resumes.

This job is found at InterviewStack.io

Skills

databrickssnowflakehipaaanalyticsragllmawsgcpazures3bigqueryvertex aidata warehousingcontainerizationdockerpulumidata modelingicebergdbtmlopsnlpdesign systemsdashboardskafkapythonsparksqlfivetranautomationairflowdagsterobservabilityetlsystem designdata pipelinesmlflowtableaupower bistatisticsdata sciencedata governancelarge language modelspredictive modelingcloud architecturehigh availabilityquality assurancedata structuresdata architecture

About Oura Health

Oura Health is a health technology company focused on empowering individuals to understand and improve their health, sleep, and overall wellbeing through advanced hardware and software solutions. Their flagship product, the Oura Ring, combines cutting-edge sensors with data analytics to provide personalized health insights.

medium companyhealthtech, wearablesseries_dWebsite