InterviewStack.io LogoInterviewStack.io
Browse more Network Engineer jobs

Network Engineer

AnaVation

Chantilly, VA6 months ago
31 views18 saves0 applies

Prepare for this role


Benefits

Health InsuranceDental & VisionPaid Time Off401kRetirement Plan

Job Type

full time

Description

Be Challenged and Make a Difference
In a world of technology, people make the difference. We believe if we invest in great people, then great things will happen. At AnaVation, we provide unmatched value to our customers and employees through innovative solutions and an engaging culture.
AnaVation is seeking a Senior level Network Engineer to design, install, maintain, and evaluate network and communications systems. This role will gather user network requirements, produce clear technical documentation, and support a multi-enclave environment that enables secure access to data across the network infrastructure.
Key Responsibilities
•Design, install, maintain, and evaluate network systems and communications systems
•Gather user network requirements utilizing multiple methodologies
•Provide necessary technical documentation, system requirements documents, and security requirements
•Troubleshoot and resolve network issues involving various protocols, topologies, and networking hardware
•Assist with network architecture design, feasibility, and cost studies
•Improve processes for deploying and maintaining network infrastructure
•Work independently and collectively to help improve network solutions
•Design, deploy, test, certify, and patch network components including switches, firewalls, and load balancers
•Address interoperability issues for all features, components, and application dependencies
•Respond to and resolve critical network incidents within designated resolution timelines

Required Qualifications:

  • Bachelor's degree in Computer Science, Cyber security, or related field.
  • Minimum of 8 years of experience in cyber operations, cyber security, or related field.
  • Active Top Secret (TS) clearance with eligibility for Sensitive Compartmented Information (SCI) with a CI polygraph.
  • Strong understanding of multi-enclave network environments.
  • Demonstrated experience designing and implementing secure networks in government environments.
  • Experience with SAFe Agile framework.
  • Advanced proficiency with:
  • Network hardware (Cisco, Arista, SonicWall)
  • Network protocols (TCP/IP, DNS, DHCP, HTTP/S)
  • Firewall configuration and management
  • Load balancer implementation
  • Software-defined networking
  • VPN technologies
  • Network security principles and practices
  • Network monitoring and troubleshooting tools
  • Network performance optimization
  • Cloud networking (AWS GovCloud, SC2S, C2S)
  • Containerization networking (Docker, Kubernetes)
  • Infrastructure as Code (Terraform)
  • Tunneling protocols (GRE, IPSec, SSH, SSL)
  • Cross-domain solutions
  • Network automation and orchestration

Desired Qualifications:

  • Relevant network certifications (CCNP, CCIE, or equivalent) preferred
  • Experience with Nutanix
  • DevSecOps practices and tools
Benefits
  • Generous cost sharing for medical insurance for the employee and dependents
  • 100% company paid dental insurance for employees and dependents
  • 100% company paid long-term and short-term disability insurance
  • 100% company paid vision insurance for employees and dependents
  • 401k plan with generous match and 100% immediate vesting
  • Competitive Pay
  • Generous paid leave and holiday package
  • Tuition and training reimbursement
  • Life and AD&D Insurance
About AnaVation
AnaVation is the leader in solving the most complex technical challenges for collection and processing in the U.S. Federal Intelligence Community. We are a US owned company headquartered in Chantilly, Virginia. We deliver groundbreaking research with advanced software and systems engineering that provides an information advantage to contribute to the mission and operational success of our customers. We offer complex challenges, a top-notch work environment, and a world-class, collaborative team.
If you want to grow your career and make a difference while doing it, AnaVation is the perfect fit for you!
AnaVation is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to sex, race, color, religion, national origin, disability, protected Veteran status, age, or any other characteristic protected by law.

This job is found at InterviewStack.io

Skills

firewallstypescriptagilednsdhcpvpnmonitoringawscontainerizationdockerkubernetesinfrastructure as codeterraformsslautomationdevsecopsperformance optimizationtechnical documentationnetwork securitysystems engineering

About AnaVation

AnaVation is a trusted partner that delivers high-value, cost-effective solutions to solve customers' most complex technical and analytical problems, providing professional services to U.S. federal government agencies.

software, cybersecurityWebsite