Back End Developer
NXTThing RPO
RemoteRemote2 days ago
6 views2 saves1 applies
Prepare for this role
Benefits
Dental & VisionPaid Time Off
Job Type
full time
Description
About Us:
At NXTThing, we’re redefining the future of talent acquisition. We believe hiring is both an art and a science, and we’re building a new approach that combines innovative technology, data-driven insights, and the human expertise needed to transform how companies attract, engage, and hire talent.
Through our recruitment solutions, Personegy™ hiring platform, and Talentegy™ analytics solutions, we bring together people, technology, and data to challenge traditional hiring models and create smarter talent experiences.
Join us as we continue rewriting the playbook for talent acquisition and building what’s next in the future of hiring.
Position Summary:
We are seeking a Senior Back End Developer with expertise in Ruby on Rails, React, AWS, and modern cloud-native development practices to join our growing development team. This is a long-term contract opportunity for a highly skilled engineer who enjoys building scalable web applications, designing robust architectures, and working in a fast-paced environment.
Key Responsibilities:
If you're ready to take your career to the NXT level and make a meaningful impact in a fast-paced, innovative environment, we want to hear from you. Join us at NXTThing RPO and be part of a team that's shaping the future of recruitment process outsourcing. Apply now and unleash your potential with us.
What We Offer:
At NXTThing, we’re redefining the future of talent acquisition. We believe hiring is both an art and a science, and we’re building a new approach that combines innovative technology, data-driven insights, and the human expertise needed to transform how companies attract, engage, and hire talent.
Through our recruitment solutions, Personegy™ hiring platform, and Talentegy™ analytics solutions, we bring together people, technology, and data to challenge traditional hiring models and create smarter talent experiences.
Join us as we continue rewriting the playbook for talent acquisition and building what’s next in the future of hiring.
Position Summary:
We are seeking a Senior Back End Developer with expertise in Ruby on Rails, React, AWS, and modern cloud-native development practices to join our growing development team. This is a long-term contract opportunity for a highly skilled engineer who enjoys building scalable web applications, designing robust architectures, and working in a fast-paced environment.
Key Responsibilities:
- Design, develop, and maintain highly scalable web applications using Ruby on Rails on the backend and React.js/TypeScript on the frontend.
- Architect and implement robust, scalable, secure, and maintainable backend solutions, integrating multiple data sources and databases.
- Develop responsive and user-friendly front-end interfaces using React.js, TypeScript, HTML5, and CSS3.
- Design and optimize PostgreSQL database schemas, queries, indexing strategies, and overall database performance.
- Build and maintain RESTful APIs and GraphQL services for internal and external integrations.
- Optimize application performance, reliability, maintainability, and security across the entire technology stack.
- Ensure high code quality through best practices, including code reviews, unit testing, integration testing, and end-to-end testing.
- Collaborate with product managers, business stakeholders, designers, and engineering teams to define, design, and deliver new features.
- Work with AWS services (EC2, ECS/EKS, S3, RDS, SES, Lambda, CloudWatch, IAM, Route53, etc.) to ensure high availability, scalability, and security of applications.
- Develop and maintain containerized applications using Docker.
- Maintain and improve CI/CD pipelines to streamline testing, deployment, and release processes.
- Implement monitoring, logging, and observability solutions using tools such as CloudWatch, Datadog, New Relic, Sentry, or similar platforms.
- Participate in architectural discussions, technical planning, and technology selection decisions.
- Mentor junior developers and contribute to engineering best practices.
- Stay current with emerging technologies, industry trends, and software development best practices.
- Bachelor's degree in Computer Science, Mathematics, or related technical field required; Master's degree preferred.
- 7+ years of professional software development experience, including significant experience building and maintaining production-grade web applications.
- Strong expertise in Ruby on Rails, with a deep understanding of Ruby and its ecosystem.
- Strong understanding of object-oriented programming principles, software design patterns, and scalable application architecture.
- Extensive experience with React.js and modern JavaScript (ES6+).
- Strong experience with TypeScript in modern React applications.
- Experience with HTML5, CSS3, responsive design, and modern front-end development practices.
- Familiarity with state management libraries such as Redux and React Context.
- Strong knowledge of RESTful API design, GraphQL, and API security best practices.
- Experience designing and optimizing PostgreSQL databases, including schema design, indexing, and performance tuning.
- Experience integrating and managing multiple databases and external data sources.
- Understanding of MVC architecture, ORM frameworks, and domain-driven design principles.
- Experience with Docker and containerized application development.
- Experience building and maintaining CI/CD pipelines.
- Hands-on experience deploying and managing applications within AWS environments.
- Knowledge of web application security principles, including authentication, authorization, OWASP best practices, and secure API design.
- Experience with Git and modern version control workflows.
- Strong problem-solving, communication, and collaboration skills.
- Demonstrated ability to take ownership of projects from conception through deployment and ongoing support.
- Ability to work independently with minimal supervision and refine requirements in collaboration with business stakeholders.
- Ability to overlap East Coast hours at least from 8:00 AM – 12:00 PM ET.
- Experience with distributed systems, microservices architecture, and event-driven applications.
- Experience with Redis, Sidekiq, Elasticsearch/OpenSearch, or similar technologies.
- Experience integrating third-party APIs and AI/LLM platforms such as OpenAI, Anthropic, or AWS Bedrock.
- Experience with infrastructure-as-code tools such as Terraform or CloudFormation.
- Advanced or fluent Russian/Belarusian language skills.
- Bachelor's or Master's degree in Computer Science, Software Engineering, or equivalent practical experience.
- Experience mentoring developers and leading technical initiatives.
If you're ready to take your career to the NXT level and make a meaningful impact in a fast-paced, innovative environment, we want to hear from you. Join us at NXTThing RPO and be part of a team that's shaping the future of recruitment process outsourcing. Apply now and unleash your potential with us.
What We Offer:
- Unlimited paid time off
- 2, 1-week shutdowns per year
- Paid holidays
- Company paid medical, dental & vision insurance
- Strong work-life balance
This job is found at InterviewStack.io
Skills
analyticsrubyrailsreactawstypescripthtml5postgresqlrestful apisgraphqlunit testingintegration testingec2ecsekss3lambdacloudwatchiamscalabilityci/cdmonitoringobservabilitydatadognew relicsentryjavascriptcss3responsive designreduxdomain-driven designdockerowaspgitdistributed systemsmicroservicesredissidekiqelasticsearchapisllmopenaiterraformtalent acquisitionobject oriented programmingcode reviewhigh availabilityapplication security
About NXTThing RPO
At NXTThing RPO, our mission is to empower organizations to achieve success through strategic and meaningful hires, ensuring every candidate feels valued, heard, and respected. Comprehensive talent services blending technology and human connection.
recruitment process outsourcing, talent acquisitionWebsite