InterviewStack.io LogoInterviewStack.io
Browse more Data Engineer jobs

IND - Senior Engineer, Data

The Hartford

India GCC-Puppalaguda Village2 months ago
43 views23 saves5 applies

Prepare for this role


Job Type

full time

Description

IND - Senior Engineer, Data - GCC062

We’re determined to make a difference and are proud to be an insurance company that goes well beyond coverages and policies. Working here means having every opportunity to achieve your goals – and to help others accomplish theirs, too. Join our team as we help shape the future.

Key Responsibilities 

  • Data and AI Engineer responsible for Implementing AI data pipelines that bring together structured, semi-structured and unstructured data to support AI and Agentic solutions. This Includes pre-processing with extraction, chunking, embedding and grounding strategies to get the data ready. 

  • Real-Time Data Streaming: Build and maintain scalable and robust real-time data streaming pipelines using technologies such as Apache Kafka, AWS Kinesis, Spark streaming, or similar. 

  • Develop AI-driven systems to improve data capabilities 

  • Implement efficient Retrieval-Augmented Generation (RAG) architectures and integrate with enterprise data infrastructure.  

  • Develop data domains and data products for various consumption archetypes including Reporting, Data Science, AI/ML, Analytics etc. 

  • Ensure the reliability, availability, and scalability of data pipelines and systems through effective monitoring, alerting, and incident management. 

  • Model domain entities, relationships, and business logic in knowledge graphs (e.g., Neo4j, Amazon Neptune, RDF). 

  • Implement scalable semantic layer with  dynamic query translation to deliver real time insights for conversational analytics. 

  • Collaborate closely with DevOps and infrastructure teams to ensure seamless deployment, operation, and maintenance of data systems. 

  • Develop graph database solution for complex data relationships supporting AI systems. 

 

 

 

Required Skills & Experience 

  • Bachelor's degree in Computer Science, Artificial Intelligence, or related field. 

  • 3+ years of data engineering experience including Data solutions, SQL and NoSQL, Snowflake, ETL/ELT tools, CICD, Bigdata, Cloud Technologies (AWS/Google/AZURE), Python/Spark, Datamesh, Datalake or Data Fabric. 

  • 2+ years’ experience with cloud platforms (AWS, GCP, or Azure) 

  • 1+ years of data engineering experience focused on supporting AI technologies. 

  • 1+ years of hands-on experience implementing AI data solutions. 

  • 1+ years' experience with prompt engineering techniques for large language models. 

  • 1+ years of implementing Retrieval-Augmented Generation (RAG) pipelines, integrating retrieval mechanisms with language models. 

  • 1+ years of implementing AI driven data systems supporting agentic solution (AWS Lambda, S3, EC2, Langchain, Langgraph). 

  • 2+ years programming skills in Python and familiarity with deep learning frameworks such as PyTorch or TensorFlow. 

  • 1+ years with building AI pipelines that bring together structured, semi-structured and unstructured data.   

  • 1+ years in vector databases, graph databases, NoSQL, Document DBs, including design, implementation, and optimization. (e.g., AWS open search, GCP Vertex AI, Neo4j, Spanner Graph, Neptune, Mongo, DynamoDB etc.). 

  • Strong written and verbal communication skills 

  • Able to communicate effectively with technical teams   

  • Team player who collaborates effectively across teams   

  • Strong organization and execution skills. 

  • Strong interpersonal and time management skills  

  • Ability to work successfully in a lean, agile, and fast-paced organization, leveraging Agile principles and ways of working.  

  • Ability to translate technical topics into business solutions and strategies 

About Us | Our Culture | What It’s Like to Work Here

This job is found at InterviewStack.io

Skills

data pipelinesapachekafkaawssparkraganalyticsscalabilitymonitoringneo4jsqlnosqlsnowflakeetlci/cdazurepythongcplambdas3ec2langchainlanggraphdeep learningpytorchvector databasesvertex aidynamodbagileincident managementdata sciencelarge language modelsprompt engineering

About The Hartford

The Hartford is a United States-based investment and insurance company offering a wide range of insurance products and employee benefits solutions. It serves individuals and businesses with property and casualty insurance, group benefits, and mutual funds.

large companyinsurance, financepublicWebsite