InterviewStack.io LogoInterviewStack.io
Browse more Frontend Developer jobs

Java Spring Microservices

Zensar

Chennai, Tamil Nadu, IndiaRemote2 weeks ago
22 views7 saves0 applies

Prepare for this role


Benefits

Dental & Vision

Job Type

full time

Description

Backend Engineering & API Development

Design, develop, and maintain high-performance Java-based RESTful APIs and microservices serving member-facing digital products.

Build and evolve core Member Services platform capabilities including account management, card servicing, rewards, benefits inquiry, and transaction history.

Develop event-driven architectures using Apache Kafka for real-time member data processing, notifications, and service orchestration.

Implement GraphQL APIs to support flexible, efficient data delivery to mobile and web front-end clients.

Ensure API contracts are robust, versioned, well-documented, and backward-compatible across consumer teams.

Microservices & Cloud-Native Architecture

Design loosely coupled, independently deployable microservices following domain-driven design (DDD) principles.

Deploy and manage services on cloud platforms (AWS / GCP / Azure) using containerization (Docker) and orchestration (Kubernetes / OpenShift).

Implement service mesh patterns, circuit breakers, retries, and rate limiting for resilient inter-service communication.

This job is found at InterviewStack.io

Skills

restful apismicroservicesapachekafkagraphqlapisdomain-driven designawsgcpazurecontainerizationdockerkubernetesaccount managementapi development

About Zensar

Zensar is a global technology services company that provides IT consulting and technology solutions. The company operates in multiple countries including India and uses Oracle Cloud as its ATS platform.

large companytechnology, consultingpublicWebsite