InterviewStack.io LogoInterviewStack.io
Browse more Data Engineer jobs

Busines Intelligence Engineer III

Blue Origin

Greater Seattle Area$130,706+1 month ago
76 views37 saves7 applies

Prepare for this role


Benefits

Dental & VisionPaid Time OffParental Leave401kRetirement Plan

Job Type

full time

Description

Application close date:

Applications will be accepted on an ongoing basis until the requisition is closed.

At Blue Origin, we envision millions of people living and working in space for the benefit of Earth. We’re working to develop reusable, safe, and low-cost space vehicles and systems within a culture of safety, collaboration, and inclusion. Join our team of problem solvers as we add new chapters to the history of spaceflight!  

This role is part of Blue Origin corporate functions, providing centralized support across Blue Origin business unit teams, functions, and locations.

Job Profile: Business Intelligence Engineer III

This role supports the SFB Data Analytics & Technology team, which provides critical data analytics and technology development capabilities to Blue Origin's Operations and Strategy, Finance & Business (SFB) organization.

As a Business Intelligence Engineer III on the SFB Data Analytics & Technology team, you will be a strong individual contributor who leads your own analytics and data solution projects across the ORBIT platform and other emerging SFB initiatives. Your work will center on designing KPI frameworks, architecting dimensional models and semantic layers, and delivering insight-driven solutions that translate complex business data into clear, actionable intelligence. You will work deeply with Databricks and Blue Origin's broader data ecosystem, building robust data pipelines, and integrating with enterprise APIs to power the analytics experiences that leadership depends on. You will collaborate closely with business leaders, data owners, operations and finance stakeholders throughout Blue Origin to structure ambiguous problems and deliver scalable transformative solutions that directly support decision-making at the highest levels of the company.

Your day-to-day activities will include designing and optimizing complex SQL and semantic layers, architecting dimensional models and data marts, implementing data quality checks and pipeline observability, and building parameterized BI assets tuned for performance. You will prototype custom visualizations using lightweight web components and SDKs, and develop persona-tailored data stories with cross-domain context and well-defined metrics. You will leverage AI-powered development tools to accelerate delivery while critically evaluating outputs for analytical rigor, architectural fit, and long-term maintainability. Working in a fast-paced, highly responsive environment, you will lead the translation of complex, multi-variable business requirements into scalable BI solutions through structured problem scoping, root cause analysis, and proactive stakeholder engagement.

This position offers long-term opportunity as the SFB Data Analytics & Technology team scales its analytics impact beyond ORBIT into new domains supporting Operations and SFB. You will gain broad exposure to business operations, finance, and strategy across the company, deepen your data engineering and BI architecture expertise, and work on solutions that directly influence how Blue Origin measures and runs the business. You will lead your own projects with autonomy and impact, collaborate effectively across the organization, and develop the technical depth and cross-functional influence that defines a strong BI engineering career.

We are looking for someone to apply their analytical depth, technical expertise, and collaborative mindset to drive meaningful impact across our Operations and SFB organizations. Passion for our mission and vision is required!

Responsibilities include but are not limited to:

  • Leading end-to-end development and enhancement of the ORBIT KPI visualization platform
  • Driving rapid development of BI solutions for the SFB organization, from requirements through delivery
  • Designing and maintaining semantic layers, dimensional models, and data marts in Databricks
  • Implementing data quality checks, pipeline observability, and storage/compute optimization
  • Developing and maintaining robust Python packages with CI/CD and data validation
  • Writing and optimizing complex SQL for analytics and reporting use cases
  • Designing KPI frameworks and performing root cause analysis and scenario modeling with business stakeholders
  • Prototyping custom application visualizations using lightweight web components (e.g., GitLab Pages, Steamlit, other lightweight app framework)
  • Leading requirements development and problem scoping across Operations and SFB stakeholder groups
  • Leading multi-team projects including timeline management, dependency tracking, and post-mortems
  • Setting analytical and technical standards and representing the team in cross-functional forums
  • Building and maintaining comprehensive technical and analytical documentation

Minimum Qualifications:

  • BS in Business Analytics, Data Science, Computer Science, Information Systems, or equivalent degree field
  • 5+ years of experience in business intelligence, data analytics, or a related technical field (fewer with advanced degree)
  • Expert-level SQL skills including CTEs, window functions, query optimization, and semantic layer design
  • 4+ years experience with Databricks or equivalent cloud data platforms
  • Experience architecting dimensional models, data marts, and parameterized BI assets
  • Experience implementing data quality checks, pipeline observability, and CI/CD for data workflows
  • Demonstrated ability to lead multi-team projects and drive delivery across stakeholder groups
  • 1+ years of experience leveraging LLMs and AI-powered tools in an analytics or development workflow
  • 2+ years of experience with AWS

Preferred Qualifications:

  • Demonstrated ability to design KPI frameworks and translate complex business processes into measurable metrics
  • Familiarity with React/TypeScript for building analytics views or lightweight front-end integrations
  • Experience with REST or GraphQL API integration in a BI or data context
  • Experience supporting operations, finance, and/or strategy use cases
  • Experience conducting formal post-mortems and implementing process improvements
  • Deep experience with AWS


 

Compensation Range for:

WA applicants is $130,706.00 - $182,987.70

Other site ranges may differ

Culture Statement

Don’t meet all desired requirements? Studies have shown that some people are less likely to apply to jobs unless they meet every single desired qualification. At Blue Origin, we are dedicated to building an authentic workplace, so if you’re excited about this role but your past experience doesn’t align perfectly with every desired qualification in the job description, we encourage you to apply anyway. You may be just the right candidate for this or other roles.

Export Control Regulations

Applicants for employment at Blue Origin must be a U.S. citizen or national, U.S. permanent resident (i.e. current Green Card holder), or lawfully admitted into the U.S. as a refugee or granted asylum.

Background Check

  • Required for all positions: Blue’s Standard Background Check

  • Required for Certain Job Profiles:  Defense Biometric Identification System (DBIDS) background check if at any time the role requires one to be on a military installation

  • Required for Certain Job Profiles: Drivers who operate Commercial Motor Vehicles with a Gross Vehicle Weight (GVW), Gross Vehicle Weight Rating (GVWR) or combination of power unit and trailer that meets or exceeds 10,001 lbs. and/or transports placardable amounts of hazardous materials by ground in any vehicle on a public road while in commerce, may be subject to additional Federal Motor Carrier Safety Regulations including: Driver Qualification Files, Medical Certification (obtained before onboarding), Road Test, Hours of Service, Drug and Alcohol Testing (CDL drivers only), vehicle inspection requirements, CDL requirements (if applicable) and hazardous materials transportation/shipping training.

  • Required for certain Job Profiles: Ability to obtain and maintain Merchant Mariner Credential, which includes pre-employment and random drug testing as well as DOT physical

Benefits

  • Benefits include:  Medical, dental, vision, basic and supplemental life insurance, paid parental leave, short and long-term disability, 401(k) with a company match of up to 5%, and an Education Support Program.

  • Stock Options for all regular employees (working at least 20 hours/week)

  • Paid Time Off:  Up to four (4) weeks per year based on weekly scheduled hours, and up to 14 company-paid holidays.

  • Dependent on role type and job level, employees may be eligible for benefits and bonuses based on the company's intent to reward individual contributions and enable them to share in the company's results, or other factors at the company's sole discretion. Bonus amounts and eligibility are not guaranteed and subject to change and cancellation. Please check with your recruiter for more details.

Equal Employment Opportunity

Blue Origin is proud to be an Equal Opportunity/Affirmative Action Employer and is committed to attracting, retaining, and developing a highly qualified and dedicated work force. Blue Origin hires and promotes people on the basis of their qualifications, performance, and abilities. We support the establishment and maintenance of a workplace that fosters trust, equality, and teamwork. We provide all qualified applicants for employment and employees with equal opportunities for hire, promotion, and other terms and conditions of employment, regardless of their race, color, religion, sex, sexual orientation, gender identity, national origin/ethnicity, age, physical or mental disability, genetic factors, military/veteran status, or any other status or characteristic protected by federal, state, and/or local law. Blue Origin will consider for employment qualified applicants with criminal histories in a manner consistent with applicable federal, state, and local laws, including the Washington Fair Chance Act, the California Fair Chance Act, the Los Angeles Fair Chance in Hiring Ordinance, and other applicable laws. For more information on “Know Your Rights,” please see here.

Affirmative Action and Disability Accommodation

Applicants wishing to receive information on Blue Origin’s Affirmative Action Plans, or applicants requiring a reasonable accommodation in order to participate in the application and/or interview process, please contact us at EEOCompliance@blueorigin.com. Please note this is a publicly managed inbox. Please do not include any personal medical information in your request.

This job is found at InterviewStack.io

Skills

analyticsdatabricksdata pipelinesapissqlobservabilitypythonci/cdprototypinggitlabllmsawsreacttypescriptgraphqlprocess improvementroot cause analysisdata sciencedata qualitybusiness intelligenceapi integrationstakeholder engagement

About Blue Origin

Blue Origin builds reusable rocket engines, launch vehicles, in-space systems, and lunar landers. Join us in building a road to space for the benefit of Earth and become a part of history.

aerospace, space technologyWebsite