InterviewStack.io LogoInterviewStack.io
Browse more Backend Developer jobs

Staff Forward Deploy Engineer

SentinelOne

United States - RemoteRemote$156,000 - $215,0001 month ago
92 views34 saves13 applies

Prepare for this role


Benefits

EquityHealth InsuranceDental & VisionParental Leave401kRetirement PlanStock OptionsWellness ProgramHome Office Stipend

Job Type

full time

Description

Our Purpose

At SentinelOne, we are driven by a clear purpose: to give the advantage to those who secure our future. As AI reshapes how organizations build, operate, and innovate, the responsibility to protect them becomes more critical than ever. When you join SentinelOne, your work helps protect global enterprises, critical infrastructure, and the technologies shaping tomorrow. If you are motivated by meaningful challenges and want your impact to be real, measurable, and global, you will find purpose here.

About Us

SentinelOne is a company at the intersection of AI and security, pioneering a new operating model for cybersecurity. Our AI-native platform unifies protection across endpoint, cloud, identity, data, and AI systems to deliver autonomous detection and response with clarity and speed. By combining real-time analytics, intelligent automation, and a unified data foundation, we reduce noise, simplify complexity, and empower security teams to focus on what truly matters.

Our teams are builders, problem-solvers, and innovators committed to shaping the future of security. If you are excited to solve hard problems alongside talented, mission-driven people, we invite you to help us build a safer future for humanity.

What Are We Looking For?

We’re looking for people who are relentlessly curious and committed to continuous learning. AI is reshaping every function across our business, and we enable every team member, regardless of role or level, to build fluency in AI tools and concepts. Those who thrive here actively seek out new solutions, experiment thoughtfully, and apply what they learn to drive better, faster, smarter outcomes.

As a Staff Forward Deploy Engineer at SentinelOne, you will sit at the intersection of our customers and our product. Your time splits between customer engineering teams and our own codebases– shipping the integrations, fixes, and platform improvements customer deployments require. Your work will touch many products and services across the company including our data pipeline and the Singularity Data Lake and EventDB (our highly scalable columnar database that ingests Petabytes of data per day).

You'll work closely with customers to understand their environments, translate ambiguous requirements into shipped solutions, and build integrations, customizations, and upstream product contributions that unlock real business value. We're seeking a seasoned colleague, able to own customer engagements end-to-end, inspire others as a Staff Forward Deploy Engineer, and lead technically across unfamiliar codebases and messy problem spaces. You will interact with engineers in and across the org, tech leads, architects, product management, sales, and customer executive stakeholders.

What Will You Do?

  • Software Development (fullstack; primarily React/Java)
    Dive deep into coding, turning customer requirements and product gaps into shipped solutions. Write robust tests, tackle bugs with finesse, and ensure top-notch security in your code. Expect to move between codebases regularly, including on escalated issues that span multiple products.
  • Customer Engagement and Requirements Gathering
    Partner with customers and our field teams to understand customer environments, goals, and constraints. Turn loose, ambiguous (possibly contradictory!) asks into a clear technical strategy. Carry field learnings back into product and engineering planning while advocating for what customers need. Occasionally support pre-sales scoping where early engineering input shapes a good outcome.
  • Customer Integrations, Deployments, and Enablement
    Own the design and delivery of integrations that connect SentinelOne products into customer environments. Often this is work you will do alongside the customer's engineers, shaping both the solution and the knowledge transfer that goes with it. Produce the runbooks, integration docs, and executive-level technical communication that let customers operate independently.
  • Upstream Contributions to the Core Product
    When something needs fixing or improving in the core platform to make a customer whole, you go do it. Partner with platform teams to get contributions reviewed and supported long-term, and know when to invest in the long-term fix versus the near-term unblock. Along the way, build the tooling that codifies repeatable patterns and scales the whole Forward Deploy function.
  • Technical Leadership and Mentorship
    Raise the bar for the Forward Deploy Engineering team. Mentor Senior Forward Deploy Engineers, set standards for how engagements are scoped and delivered, and shape how the team operates as it grows.
  • Build and Review Technical Specifications
    Architect end-to-end solutions for complex problems with loose definition, sometimes spanning multiple codebases and owning teams. Document trade-offs and critical implementation details; review and provide meaningful feedback on other specs, understanding broader patterns and downstream/upstream dependencies.
  • Code Review
    Champion code quality, security, and efficiency. Your keen eye for detail will guide you in reviewing and elevating our codebase– including the codebases you're visiting.
  • Support and Team Collaboration
    Respond to ad-hoc customer and internal escalations promptly (no regular on-call rotation). Assist your colleagues, share constructive feedback, and contribute to weekly syncs and daily Slack standups.

What Skills and Knowledge Will You Bring?

We do not require a perfect match with everything below; however, the more this describes you, the better of a fit you will be for this role.

  • Experience
    • Solid computer science background with 6+ years engineering experience including both backend and frontend.
    • Proven expertise designing and operating distributed systems or data-intensive services.
    • Track record of leading substantial pieces of work end-to-end, under ambiguity, with multiple stakeholders.
    • Experience working directly with customers or senior stakeholders to shape technical solutions.
  • Technical Mastery
    • Deep proficiency in at least one production language (Java strongly preferred; 5+ years) and working comfort in at least one additional language.
    • You value elegant code that is concise and readable.
    • You'll pick up new tools and codebases as the work demands, and will likely end up working with modern Java, React, TypeScript, Kafka, Redis, GraphQL, Node.js, SentinelOne's own platform, and more.
    • You enjoy writing modern Java (we love lambdas) and prefer composition to inheritance.
    • You're comfortable weighing in on CAP theorem considerations, and are energized by selecting the data structure with the perfect trade-offs for a problem at hand.
  • Domain Familiarity
    • Experience in the cybersecurity domain is strongly preferred. (think SIEM, EDR/XDR, log pipelines, detection engineering, threat hunting, etc.).
  • A Collaborative, Curious, and Practical Mindset
    • You're energized by walking into an unfamiliar codebase and being genuinely useful in a week, and by leading others through the same kind of work.
    • You believe a vague customer request is an interesting technical problem waiting to be reframed, and that "a problem well-stated is half-solved."
    • You can translate between engineers and non-engineers (customers, executives, sales, product, etc.) without losing precision in either direction.
    • You'd rather ship a well-thought-out 80% that solves the real problem than a perfect 100% six weeks late. And you can teach others when to customize for one customer versus producing a general solution.
    • You take mentorship seriously and enjoy seeing other engineers grow in their ability to solve harder problems.
    • You take pride in clear written communication — tickets, design docs, customer runbooks, and executive briefings alike.

Why SentinelOne?

AI is redefining how the world operates and rewriting the rules of security in real time, and SentinelOne was built for this moment. From day one, we architected an AI-native platform designed to operate at machine speed, not as an add-on to legacy systems but as the foundation itself. If you want to build where innovation and impact move together, this is that place.

We invest in our Sentinels with comprehensive, competitive benefits designed to support you and your family:

Equity & Rewards

  • Restricted Stock Units (RSUs)
  • Employee Stock Purchase Plan (ESPP)

Time Off & Wellbeing

  • Flexible time off
  • Paid company holidays and paid sick time
  • Gender-neutral parental leave
  • Grandparent leave

Insurance & Financial Security

  • Medical, dental, and vision coverage
  • 401(k) retirement plan with company match
  • Life and disability insurance
  • Health and dependent care FSA
  • Voluntary benefits (hospital, accident, critical illness)
  • Employee Assistance Program (EAP)
  • ARAG pre-paid legal
  • Nationwide pet insurance
  • Cancer Care program
  • Global business travel medical insurance

Work Perks & Flexibility

  • Home office allowance
  • Mobile phone reimbursement

Wellness & Lifestyle

  • Wellness coach
  • Wellness/gym reimbursement
  • Fertility coverage
  • Adoption & surrogacy reimbursement

This U.S. role has a base pay range that will vary based on the location of the candidate. For some locations, a different pay range may apply. If so, this range will be provided to you during the recruiting process. You can also reach out to the recruiter with any questions.

Base Salary Range
$156,000$215,000 USD

SentinelOne is proud to be an Equal Employment Opportunity and Affirmative Action employer. We do not discriminate based upon race, religion, color, national origin, gender (including pregnancy, childbirth, or related medical conditions), sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or other applicable legally protected characteristics.

SentinelOne participates in the E-Verify Program for all U.S. based roles.

This job is found at InterviewStack.io

Skills

analyticsautomationdata pipelinesreactjavadistributed systemstypescriptkafkaredisgraphqlnode.jssiemedrproduct managementrequirements gatheringcode reviewthreat hunting

About SentinelOne

SentinelOne is a leading cybersecurity company specializing in AI-powered endpoint protection platforms. Recognized as a leader in Gartner's Magic Quadrant for Endpoint Protection Platforms for five consecutive years, it offers a comprehensive security platform including endpoint security, cloud security, and AI-driven threat detection and response.

large companycybersecurity, ai_mlpublicWebsite