InterviewStack.io LogoInterviewStack.io
Browse more Software Engineer jobs

Senior Software Engineer, Product Foundations

Justworks

New York, New York$167,500 - $235,0002 days ago
38 views17 saves2 applies

Prepare for this role


Benefits

Remote WorkWellness Program

Job Type

full time

Description

Who We Are

At Justworks, you’ll enjoy a welcoming and casual environment, great benefits, wellness program offerings, company retreats, and the ability to interact with and learn from leaders in the startup community. We work hard and care about our most prized asset - our people.

We’re helping businesses get off the ground by enabling them to focus on running their business. We solve HR issues. We’re data-driven and never stop iterating. If you’d like to work in a supportive, entrepreneurial environment, are interested in building something meaningful and having fun while doing it, we’d love to hear from you.

We're united by shared goals and shared motivations at Justworks. These are best summed up in our company values, which are reflected in our product and in our team.

Our Values

If this sounds like you, you’ll fit right in.

Product Foundations

The Product Foundations team owns a set of core platform capabilities that support customers across the Justworks experience. Our scope includes reporting and analytics, document management, training, calendars, communications, and organizational data access, serving both administrators and employees.

We focus on building intuitive, reliable, and scalable experiences that customers depend on to access information, complete critical workflows, and manage their organizations effectively. The team works at the intersection of user experience, platform capabilities, and operational efficiency, with a strong emphasis on usability, self-service, and reducing customer friction.

As a member of Product Foundations, you'll work on products that have broad impact across the platform, balancing the stability and performance of mission-critical functionality with opportunities to introduce innovative solutions. The team also led the development of the company's first AI-powered product experience, reflecting our commitment to applying emerging technologies where they can meaningfully improve customer outcomes.

Who You Are

You are self-driven and like to work with others to remove roadblocks. You are curious, and love to explore and learn new technologies. You have demonstrated the ability to build, deploy and maintain large-scale, complex applications. You care more about solutions and impacting the customer experience than using a particular tool or framework.

Your Success Profile

What You Will Work On

  • Independently own larged-scoped projects from initial discovery through launch with a focus on outcomes and customer impact
  • Collaborate with a cross functional team to find solutions to customer challenges
  • Improve the performance, reliability, and scalability of our existing systems
  • Promote engineering excellence through technical leadership, knowledge-sharing and mentorship
  • Add capabilities to our high-volume, fault-tolerant processing infrastructure
  • Enhance our testing, monitoring and continuous deployment infrastructure
  • Keep extremely sensitive data compartmentalized and secure

How You Will Do Your Work

As a Senior Software Engineer, how results are achieved is paramount for your success and ultimately result in our success as an organization. In this role, your foundational knowledge, skills, abilities and personal attributes are anchored in the following competencies:

Good judgment - the exercise of critical thinking, analyzing and assessing problems and implications, identifying patterns, making connections of underlying issues, understanding risks and developing mitigation strategies, and taking ownership of the outcome.

Resourcefulness - taking a can-do approach, even in the face of obstacles and constraints by assessing what’s in front of you and effectively and efficiently optimizing what you have, whether it's working on something new or thinking about how to do something better.

Teamwork and communication - putting our collective best together through documentation, collaboration, relationship-building, listening, empathy, recruiting, and evangelism.Influence and leadership - fostering a community of knowledge-sharing, collaboration, mentorship, and forward-thinking.

Skills and knowledge - the capacity to actively learn and apply specific domain knowledge, know-how, and best practices to continually enhance and improve.

In addition, all Justworkers focus on aligning their behaviors to our core values known as COGIS. It stands for:

  • Camaraderie - Day to day you can be seen working together toward a higher purpose. You like to have fun. You’re an active listener, treat people respectfully, and have a strong desire to know and help others.
  • Openness - Your default is to be open. You're willing to share information, understand other perspectives, and consider new possibilities. You’re curious, ask open questions, and are receptive to thoughts and feedback from others.
  • Grit - You demonstrate grit by having the courage to commit and persevere. You’re committed, earnest, and dive in to get the job done well with a positive attitude.
  • Integrity - Simply put, do what you say and say what you'll do. You’re honest and forthright, have a strong moral compass, and strive to match your words with your actions while leading by example.
  • Simplicity - Be like Einstein: “Everything should be made as simple as possible, but no simpler.”

Qualifications

  • Minimum of 5 years of professional hands-on experience
  • Mastery of modern server side languages, Golang is a plus but not required
  • Proficiency with SQL
  • Proficiency with cloud infrastructure management, preferably AWS
  • Experience supporting and mentoring other engineers and acting as a “force multiplier”
  • Experience working closely with designers and product managers

Technologies Used

  • Golang, Ruby on Rails, Javascript, MySQL, Kafka, AWS, Git, Memcache, Redis, ElasticSearch, Docker, Terraform, Kubernetes, CircleCI, DataDog

The base wage range for this position based in our New York City Office is targeted at $167,500.00 to $235,000.00 per year.

#LI-AD1 #LI-Hybrid #LI-JS1

Actual compensation is based on multiple factors that are unique to each candidate, including and not limited to skill set, level of relevant experience, and specific work location. Salary ranges for positions based in other locations may differ based on the cost of labor in that location.

For more information about Justworks’ Total Reward Philosophy, including all of the perks and benefits we are proud to offer our team members, please visit Total Rewards @ Justworks.

Diversity At Justworks

Justworks is committed to maintaining a workplace where diversity of identity, culture, and life experience is the norm and is celebrated authentically and respected consistently. Diversity in our work, our people, and our product drives creativity and innovation, entrepreneurial leadership and integrity, competitiveness, and collaboration throughout our business and in the market. We depend on our differences to make our team stronger, our workplace more dynamic, and our product accessible to all of our customers.

We’re proud to be an equal opportunity employer open to all qualified applicants regardless of race, color, ancestry, religion, sex, national origin, sexual orientation, age, citizenship, marital or familial status, disability, pregnancy, gender identity or expression, veteran status, genetic information, or any other legally protected status. Justworks is fully dedicated to providing necessary support to candidates with disabilities who may require reasonable accommodations. We also provide reasonable accommodations to employees based on their sincerely held religious beliefs, as well as for other covered reasons consistent with applicable federal, state, and local laws. If you're in need of a reasonable accommodation, please reach out to us at accommodations@justworks.com. Your comfort and success matter to us, and we're here to ensure an inclusive experience.

Our DEIB Report

This job is found at InterviewStack.io

Skills

goanalyticsscalabilitymonitoringrubyrailsjavascriptmysqlkafkaawsgitrediselasticsearchdockerterraformkubernetescircleciuser experienceinfrastructure management

About Justworks

Justworks is a modern payroll, benefits, and compliance platform that helps businesses manage their workforce with ease. Based in New York, Justworks simplifies HR tasks for small and medium-sized companies.

human resources, software as a servicelate stage ventureWebsite