InterviewStack.io LogoInterviewStack.io
Browse more UX Designer jobs

SME UX Designer

Leidos

Alexandria, VA$131,300 - $237,3501 month ago
83 views26 saves6 applies

Prepare for this role


Job Type

full time

Description

General program information and/or position overview.

This Department of War enterprise data and analytics program delivers mission-critical capabilities that enable leaders across the Department to make faster, better-informed decisions using trusted data at scale. Leidos Digital Modernization sector is seeking an experienced SME UX Designer to support the delivery, enhancement, and adoption of enterprise data and analytics products used across multiple DoD organizations.

In this role, you will work alongside government partners, engineers, and other industry teammates to translate operational and strategic requirements into scalable, production-ready solutions. You will contribute directly to product planning, execution, and continuous improvement—helping ensure capabilities are delivered efficiently, aligned to mission priorities, and positioned for sustained success.

This position offers the opportunity to work on a high-visibility, enterprise program at the intersection of data, analytics, and emerging AI technologies. Ideal candidates are motivated by mission impact, comfortable operating in complex stakeholder environments, and interested in building deep domain expertise while delivering capabilities with real-world national security outcomes.

Primary Responsibilities:

  • Define and lead user experience strategy and design standards across WDP applications and services.

  • Apply human-centered design principles to improve usability, accessibility, and user satisfaction.

  • Conduct and lead user research, usability testing, and workflow analysis to inform design decisions.

  • Develop user personas, journey maps, and interaction models to guide product design.

  • Design and oversee creation of wireframes, prototypes, and high-fidelity UI/UX designs.

  • Collaborate with UI engineers, software developers, product teams, and stakeholders to implement UX solutions.

  • Ensure UX design is integrated into Agile and DevSecOps development processes .

  • Establish and maintain design systems, style guides, and UX standards.

  • Evaluate system interfaces and recommend improvements based on user feedback and analytics.

  • Support accessibility compliance (e.g., Section 508) and usability best practices.

  • Provide expert recommendations to improve user workflows, navigation, and interaction design.

  • Support development of training materials and user guidance to improve adoption.

  • Participate in SAFe ceremonies including PI Planning, backlog refinement, sprint reviews, and retrospectives.

Basic Qualifications:

  • Active Secret clearance with SCI eligibility.

  • Bachelor’s degree in Human-Computer Interaction, UX Design, Human Factors, Psychology, Design, or related discipline and 12–15 years of relevant experience OR Master’s degree in a related field and 10–13 years of relevant experience.

  • Minimum of 8 years of experience in UX design, human-factors engineering, or related field and proficiency with UX design tools

  • Extensive experience designing user experiences for complex applications or enterprise platforms.

  • Experience conducting user research, usability testing, and workflow analysis.

  • Experience with UX design tools (e.g., Figma, Adobe XD, Sketch, or similar).

  • Experience working within Agile or DevSecOps environments.

  • Experience collaborating with cross-functional technical teams.

  • Experience in developing and implementing customer success plans.

  • Proven experience with Section 508 accessibility standards.

  • Strong understanding of interaction design, information architecture, and usability principles.

  • Excellent communication and stakeholder engagement skills.

  • Strong analytical skills and experience with user and customer analytics.

Preferred Qualifications:

  • Active TS/SCI clearance.

  • Experience supporting UX design for data platforms, analytics tools, or AI/ML systems.

  • Experience designing for multi-enclave or secure environments.

  • Experience with front-end technologies (e.g., React, Angular) to support design implementation.

  • Experience developing and maintaining enterprise design systems.

  • Familiarity with Agile or SAFe environments.

  • Portfolio demonstrating UX design work across complex systems.

  • Experience in service portfolio and service catalog management.

  • Experience designing within classified or multi-security enclave environments.

  • Knowledge of FINOPS and cost/benefit analysis for service investments.

  • Experience in designing and maintaining knowledge management systems.

  • Experience with AI/ML tools and services.

  • Knowledge of FINOPS and cost/benefit analysis for service investments.

  • Experience in designing and maintaining knowledge management systems.

If you're looking for comfort, keep scrolling. At Leidos, we outthink, outbuild, and outpace the status quo — because the mission demands it. We're not hiring followers. We're recruiting the ones who disrupt, provoke, and refuse to fail. Step 10 is ancient history. We're already at step 30 — and moving faster than anyone else dares.

Original Posting:

May 14, 2026

For U.S. Positions: While subject to change based on business needs, Leidos reasonably anticipates that this job requisition will remain open for at least 3 days with an anticipated close date of no earlier than 3 days after the original posting date as listed above.

Pay Range:

Pay Range $131,300.00 - $237,350.00

The Leidos pay range for this job level is a general guideline only and not a guarantee of compensation or salary. Additional factors considered in extending an offer include (but are not limited to) responsibilities of the job, education, experience, knowledge, skills, and abilities, as well as internal equity, alignment with market data, applicable bargaining agreement (if any), or other law.

This job is found at InterviewStack.io

Skills

analyticsaccessibilitywireframesagiledevsecopsdesign systemsfigmasketchtypescriptreactangularproduct designuser researchux designinteraction designinformation architectureusability testinguser experiencecustomer successstakeholder engagement

About Leidos

Leidos is a large American defense, aviation, information technology, and biomedical research company. It provides scientific, engineering, systems integration, and technical services primarily to the United States government. The company is headquartered in Reston, Virginia and employs thousands of people across various locations.

enterprise companydefense, technologypublicWebsite