InterviewStack.io LogoInterviewStack.io
Browse more Software Engineer jobs

Guidewire Developer

Kemper Corporation

Jacksonville, Florida1 month ago
71 views31 saves5 applies

Prepare for this role


Job Type

full time

Description

Location(s)

Alpharetta, Georgia, Birmingham, Alabama, Jacksonville, Florida

Details

Kemper is one of the nation’s leading specialized insurers. Our success is a direct reflection of the talented and diverse people who make a positive difference in the lives of our customers every day. We believe a high-performing culture, valuable opportunities for personal development and professional challenge, and a healthy work-life balance can be highly motivating and productive. Kemper’s products and services are making a real difference to our customers, who have unique and evolving needs. By joining our team, you are helping to provide an experience to our stakeholders that delivers on our promises.
 

We are seeking an experienced Guidewire ClaimCenter Developer  to be a deep technical expert in the property & casualty insurance claim domain. In this role, you will design and code scalable solutions, influence architecture, and provide guidance through technical excellence - not people management. You will work on Guidewire ClaimCenter and its surrounding middleware (Java/SpringBoot, AWS SQS/SNS, AWS Lambdas, AWS PostgreSQL, etc…).

Position Responsibilities:

  • Design robust, high-performance solutions across systems and services
  • Serve as a key technical contributor on critical projects or initiatives within the property & casualty insurance claim domain
  • Act as a resource for others by sharing deep technical knowledge and context - without formal leadership or management duties
  • Evaluate and advocate for improvements in system architecture, technical standards, and development processes
  • Collaborate with stakeholders across engineering and product to align technical implementation with business needs
  • Create proof of concepts to demonstrate capabilities
  • Enforce standard coding and security best practices
  • Work within SAFe (Scaled Agile Framework)

Position Qualifications:

  • Bachelor’s degree in computer science, computer engineering, or a related field; advanced degree preferred
  • Guidewire ClaimCenter experience is required
  • Minimum of 8 years of developer experience with at least 2 years in a senior or lead capacity. 
  • Expert-level understanding of the full SDLC
  • Ability to identify bottlenecks or inefficiencies in the software development lifecycle and propose improvements
  • Deep familiarity with wide range of software design patterns and architectural principles, applying them to design scalable and maintainable systems
  • Knowledge of auto insurance; commercial & personal auto lines a bonus
  • Expertise with most of the following:
    • Standard design patterns
    • CI/CD, Containerization and Orchestration
    • Unit testing and integration testing
    • Version control systems (e.g. Git)
    • RESTful APIs and microservices
    • AI Prompt/Agentic Engineering
    • Monitoring and logging via tools like AppDynamics and Splunk
    • Languages such as Java, Gosu, Kotlin, HTML/CSS, JavaScript, TypeScript
    • Spring Boot and container orchestration (EKS/ECS)
    • SQL and secure coding practices 
    • Cloud-native architecture and AWS services 
    • Build tools & dependency management using Maven or Gradle
    • Frameworks such as Angular, React, Vue
    • Responsive Design and Progressive Web Apps
    • Build tools & packaging managers such as Webpack/NPM
    • Guidewire InsuranceSuite (ClaimCenter, PolicyCenter, BillingCenter)
    • Guidewire InsuranceSuite’s PCF, message queues, business rules
    • Screen design using Guidewire InsuranceSuite’s PCF
    • Guidewire InsuranceSuite’s database model
    • Guidewire InsuranceSuite’s assignment rules
    • Integrations with internal systems and vendors using Guidewire InsuranceSuite’s REST APIs, messaging queues, and batches
    • Troubleshooting and resolving InsuranceSuite issues
    • Guidewire Profiler to analyze performance issues
  • Guidewire Cloud InsuranceSuite Professional Developer certification is preferred but not required
  • This position works in the Kemper office.

Kemper is proud to be an equal opportunity employer. All applicants will be considered for employment without attention to race, color, religion, sex, sexual orientation, gender identity, national origin, veteran, disability status or any other status protected by the laws or regulations in the locations where we operate. We are committed to supporting diversity and equality across our organization and we work diligently to maintain a workplace free from discrimination. Kemper is focused on expanding our Diversity, Equity and Inclusion efforts to align with our vision, mission, and guiding principles.  Kemper does not accept unsolicited resumes through or from search firms or staffing agencies. All unsolicited resumes will be considered the property of Kemper and Kemper will not be obligated to pay a placement fee.


Kemper will never request personal information, such as your social security number or banking information, via text or email.  Additionally, Kemper does not use external messaging applications like WireApp or Skype to communicate with candidates.  If you receive such a message, delete it.  

#LI-AK

This job is found at InterviewStack.io

Skills

javaspring bootawssqssnspostgresqlagileci/cdcontainerizationunit testingintegration testinggitrestful apismicroservicesmonitoringsplunkkotlinhtmlcssjavascripttypescripteksecssqlangularreactvueresponsive designwebpackrest apispeople management

About Kemper Corporation

Kemper Corporation is a leading insurance company headquartered in Downers Grove, Illinois, United States. It offers a wide range of insurance products including auto, home, and life insurance. The company is known for its focus on customer service and innovative insurance solutions.

large companyinsurance, financeWebsite