InterviewStack.io LogoInterviewStack.io
Browse more UX Designer jobs

Senior CX/UX Designer (AI Innovation for Tax & Accounting) – Hybrid (CT/ET) R0056827

Wolters Kluwer

USA - Coppell, TX$85,600 - $149,4001 month ago
47 views22 saves2 applies

Prepare for this role


Benefits

Remote WorkHealth InsuranceDental & VisionParental Leave401kRetirement PlanTuition Reimbursement

Job Type

full time

Description

Senior CX/UX Designer (AI Innovation for Tax & Accounting) – Hybrid (CT/ET) R0056827

Design AI-powered experiences that transform tax and accounting workflows.

About the Role

As a Senior CX/UX Designer, your mission is to create user-facing experiences that incorporate AI, machine learning, and automation into tax and accounting workflows, with a primary focus on an AI-powered tax research and guidance experience. You will design solutions that help tax professionals ask better questions, find trusted answers faster, and confidently interpret complex and evolving tax regulations.

This includes rapidly moving from hypothesis to validated customer journeys by creating multi modal prototypes and simulations, using lightweight coding concepts and AI assisted development to explore interactions and accelerate design to delivery collaboration with engineering partners.

You will collaborate closely with cross-functional teams to deliver intuitive, compliant, and scalable agentic experiences that support tax research, contextual guidance, and in-the-moment decision making.

Why This Role Matters

Tax and accounting professionals rely on accurate, explainable, and timely answers to navigate complex regulatory environments. AI can significantly improve how professionals discover, understand, and apply tax guidance, but only if designed responsibly. This role ensures that AI-driven research and answer experiences are intuitive, transparent, compliant, and user-centric.

What Success Looks Like

  • Agentic solutions improve the speed, confidence, and accuracy of tax research and question answering workflows.

  • AI-driven answers are transparent, trustworthy, and aligned with regulatory and editorial standards.

  • Solutions meet regulatory compliance, data privacy, and accessibility standards.

  • Prototypes and design systems accelerate delivery without compromising quality.

Hybrid: Eight days a month we come together in the closest office (CT/ET time zone) within 50 miles to experience the value of connecting with colleagues. You will report to the Lead CX/UX Designer and work under the leadership of the Director, CX/UX Design. This role is a part of DXG | UX/CX COE Wolters Kluwer DXG U.S., Inc. (Tax & Accounting). Please view the site office location directory for potential office preferences nationwide. | https://bit.ly/Find_A_WK_Office   | #LI-Hybrid

Division/BU About Us:   https://www.wolterskluwer.com/en/about-us/organization  https://www.linkedin.com/company/wolters-kluwer/    https://www.wolterskluwer.com/en/solutions/tax-accounting-us

Must be legally authorized to work in the United States without employer sponsorship, now or in the future.

Required Job Qualifications (2yr+ minimum in role plus 1yr+ (AI Innovation)

  • Prototyping: Strong ability to create high-fidelity interactive prototypes.

  • Proven experience designing AI-powered user experiences for enterprise applications.

  • Familiarity with agentic workflows, automation principles, ML concepts, and systems design.

  • Expertise in enterprise UX for regulated domains, with tax planning, compliance, or accounting experience preferred.

  • Strong understanding of data privacy, compliance, and ethical AI.

  • Wireframing: Advanced skills in creating detailed and user-centered wireframes and user flows.

  • User Research: Proficiency in planning, conducting, and analyzing comprehensive user research studies.

  • Working knowledge of front-end development concepts such as HTML, CSS, and component-based systems, and experience using AI-assisted tools to prototype interactions and accelerate iteration.

  • Usability Testing: Expertise in leading usability tests and deriving impactful design insights.

  • Advanced prototyping and design system integration skills.

  • Experience facilitating design thinking workshops and JTBD mapping.

  • Collaboration: Excellent communication and teamwork skills to align cross-functional efforts.

  • Presentation: Advanced skills in presenting design rationale and user research findings.

  • Accessibility: Competence in designing accessible user experiences according to standards.

Responsibilities

  • Avg. 1-4 trips per year | per business demand

  • Lead the design of user-facing agentic workflows for tax and accounting professionals, including AI-driven tax planning, scenario analysis, and projection-based experiences, and deliver high-fidelity prototypes for complex projects such as predictive UX and conversational interfaces

  • Collaborate with research partners to plan and conduct comprehensive user research studies and usability tests focused on planning, what-if analysis, and decision confidence.

  • Create tax and accounting solutions tailored for compliance-heavy environments in North America, with an understanding of planning considerations across filing status, income, deductions, and future events.

  • Synthesize research findings into actionable design recommendations.

  • Develop and uphold design systems and ensure consistency across products.

  • Mentor junior team members and provide constructive feedback on their work.

  • Drive collaboration with product managers, engineers, and other stakeholders as part of the empowered product team to align design goals with business objectives and bring designs to life.

  • Drive the iterative design process based on user feedback and usability testing.

  • Stay up to date with the latest UX design trends and technologies.

  • Present and defend design decisions based on user research and best practices.

  • Ensure adherence to financial data privacy, security, and WCAG accessibility standards.

Additional Information:

Wolters Kluwer offers a wide variety of competitive benefits and programs to help meet your needs and balance your work and personal life, including but not limited to: Medical, Dental, & Vision Plans, 401(k), FSA/HSA, Commuter Benefits, Tuition Assistance Plan, Vacation and Sick Time, and Paid Parental Leave.   https://www.wolterskluwerbenefitsguide.com/welcome/

Company Overview

Wolters Kluwer (EURONEXT: WKL) is a global leader in professional information, software solutions, and services for the healthcare, tax and accounting, financial and corporate compliance, legal and regulatory, and corporate performance and ESG sectors. We help our customers make important decisions every day by providing expert solutions that combine deep domain knowledge with specialized technology and services.

Wolters Kluwer reported 2022 annual revenues of €5.5 billion. The group serves customers in over 180 countries, maintains operations in over 40 countries, and employs approximately 20,000 people worldwide. We are headquartered in Alphen aan den Rijn, the Netherlands.

• Ranked by Forbes Magazine as among America’s Best Large Employers for 2022 - #84

• Wolters Kluwer secures 2nd place in Newsweek's Most Trustworthy Companies List 2023

• WK #1 for gender equality in the workplace in the Netherlands & #47 worldwide for 2023

Disclaimer: The above statements are intended to describe the general nature and level of work being performed. They are not intended to be an exhaustive list of all responsibilities and requirements. The job description provided is subject to revision and modification at any time.

Our Interview Practices

To maintain a fair and genuine hiring process, we kindly ask that all candidates participate in interviews without the assistance of AI tools or external prompts. Our interview process is designed to assess your individual skills, experiences, and communication style. We value authenticity and want to ensure we’re getting to know you—not a digital assistant. To help maintain this integrity, we ask to remove virtual backgrounds and include in-person interviews in our hiring process. Please note that use of AI-generated responses or third-party support during interviews will be grounds for disqualification from the recruitment process.

Applicants may be required to appear onsite at a Wolters Kluwer office as part of the recruitment process.

 

Compensation:

$85,600.00 - $149,400.00 USD

 

This role is eligible for Bonus.

Compensation range listed is based on primary location of the position.  Actual base salary offer is influenced by a wide array of factors including but not limited to skills, experience and actual hiring location. Your recruiter can share more information about the specific offer for the job location during the hiring process. 

Additional Information:

Wolters Kluwer offers a wide variety of competitive benefits and programs to help meet your needs and balance your work and personal life, including but not limited to: Medical, Dental, & Vision Plans, 401(k), FSA/HSA, Commuter Benefits, Tuition Assistance Plan, Vacation and Sick Time, and Paid Parental Leave. Full details of our benefits are available upon request.

This job is found at InterviewStack.io

Skills

machine learningautomationaccessibilitydesign systemsprototypingwireframingwireframeshtmlcssuser researchux designusability testinguser experiencedesign thinkingtax planningregulatory compliancedata privacysystem integrationuser flows

About Wolters Kluwer

Wolters Kluwer is a global leader in information, software solutions and services for professionals in healthcare, tax and accounting, financial and corporate compliance, legal and regulatory, and corporate performance and ESG. The company combines deep domain expertise with advanced technology to help professionals make informed decisions.

enterprise companyhealthcare, financepublicWebsite