InterviewStack.io LogoInterviewStack.io
Browse more Product Manager jobs

Lead Product Owner - Digital Twin & Contextualization

Marathon Petroleum Corporation

Findlay, Ohio$122,900 - $184,3001 month ago
63 views32 saves9 applies

Prepare for this role


Benefits

Dental & VisionPaid Time OffParental Leave401kRetirement PlanPerformance Bonus

Job Type

full time

Description

An exciting career awaits you

At MPC, we’re committed to being a great place to work – one that welcomes new ideas, encourages diverse perspectives, develops our people, and fosters a collaborative team environment.

Position Summary

The Lead Product Owner for the Operational Insights & Visualization-Contextualization Team leads the evolution of Marathon Petroleum’s digital twin and industrial AI capabilities, delivering high-impact digital products across Refining and the enterprise. This role drives product strategy, adoption, and value outcomes in a complex, multi‑partner ecosystem, working closely with senior leaders, engineering teams, and platform providers. Ideal candidates bring strong product leadership, business acumen, and the ability to navigate ambiguity while protecting value, relationships, and delivery outcomes.  The Lead Product Owner role Identifies, collects, and evaluates new technology ideas, strategic extensions, or enhancements to existing products and/or services to determine their potential to address customer needs and to achieve goals in revenue growth and market share. Manages product lifecycles, including intent, definition, design, planning, development, prototyping and testing. Applies design thinking techniques (e.g. user stories, wireframing, prototyping) to define product features. May work with external partners to select and customize technology products and/or services. This role requires a blend of deep product leadership experience and strong domain fluency with emphasis on key capabilities such as digital twin, data transformation & contextualization, industrial AI, 3D, and geographic information system (GIS).

 

Key Responsibilities

  • Champion the vision, strategy, and delivery of next-generation industrial digital capabilities—including digital twin, industrial AI, and data transformation—transforming complex operational realities into scalable products that unlock measurable value across maintenance, turnaround, operations, and safety workflows.
  • Responsible for continuous delivery of value to the customer through compelling and empowering customer experiences, accountable for a complex/ critical product, or multiple related products (within a product family/portfolio).
  • Has accountability for leading the development of product roadmaps, prioritizing feature releases, and aligning them with business objectives. Drives cross-functional collaboration to gather insights, prioritize initiatives, and plan releases effectively.
  • Collaborates closely with Agile teams, stakeholders, and business representatives to proactively identify and address challenges that arise during product development, ensuring successful execution of the product strategy.
  • Engages senior cross-functional leaders and proactively addresses and resolves issues, fostering effective communication, and promoting alignment between business and operations teams, UX design, product, engineering, analytics, and customer support teams.
  • Organizes stakeholder priorities and works with teams in order to align needs with resources ensuring cadence with customer value, business value, and strategic fit.​ Consults with the team during planning and grooming sessions and signs off on solutions.
  • Prioritizes product backlog, processes, and release plan (for multiple features for a complex or higher profile product) and plans the coordination of interdependencies with scrum team, across other lines of business.
  • Works with other teams, ensures team is aligned around similar goals and objectives / cross-team prioritization. Carries out ongoing analysis of product capability themes in order to support product direction.
  • Delivers product innovation, definition, deliverables planning (roadmap), and design of entirely new products to deliver against team and company goals.
  • Interprets and communicates product development builds on cross-departmental knowledge and puts the customer at the heart of all product changes.​
  • Identifies common client pain points and opportunities and defines right solutions to address; captures stakeholder concerns and implements refinements; serves as the voice of the client, bringing that perspective back to internal stakeholders; serves as an Agile product develop champion across department and/or company.

Education and Experience

  • Bachelor’s Degree in Information Systems or equivalent work experience
  • Product Owner certification required; Product Management certification preferred.
  • 7+ years of relevant product owner experience required.
  • 5+ years leading large‑scale digital platform delivery or complex IT/business transformation programs, with demonstrated ownership of cross‑functional execution, stakeholder alignment, and measurable business outcomes required.
  • 3+ years of industrial, manufacturing, energy, or asset‑intensive operations experience preferred.
  • Experience owning or leading digital platforms or data‑driven products that integrate multiple systems, sources, and users preferred.
  • Experience introducing and scaling new platforms or products preferred.

Skills

Agile Methodology – Agile project management is an iterative approach to delivering a project throughout its life cycle, taking incremental steps towards the completion of a project.

Authentic Communicator – Expresses ideas and information, both verbally and in writing, clearly and credibly. Listens to understand and fosters constructive dialogue.

Backlog Management - A prioritized list of work for the development team that is derived from the roadmap and its requirements. The most important items are shown at the top of the product backlog so the team knows what to deliver first.

Business Acumen – Applies knowledge of MPC’s business, industry and the marketplace to advance the organization’s goals. Makes decisions and recommendations clearly linked to MPC’s strategy.

Decision Making – Ability to know when and what decisions should be made and to make several decisions simultaneously in a fast-paced, rapidly changing environment.

Industry Product Knowledge – Industry product knowledge refers to a comprehensive understanding of the products and services within a particular industry. It encompasses familiarity with the features, functionalities, applications, and specifications of the products offered by companies operating in that industry. Industry product knowledge is crucial for professionals working in sales, marketing, customer service, product development, and various other roles within a company. It enables individuals to effectively communicate the value propositions of products, address customer inquiries, identify market trends, make informed business decisions, and contribute to the development and improvement of products and services within the industry. This knowledge often requires staying updated with the latest advancements, technologies, and market dynamics within the specific industry domain.

Product Development – The creation, innovation, enhancement, or improvement of an existing product, or developing an entirely new kind of product to satisfy the requirements of its end-users.

Product Lifecycle Management - The handling of a good as it moves through the typical stages of its product life: development and introduction, growth, maturity/stability, and decline.

User Experience (UX) – User Experience (UX) refers to the overall experience that a person has when interacting with a product, service, or system, especially in terms of how easy or pleasing it is to use.

MINIMUM QUALIFICATIONS:
Bachelor’s Degree in Information Technology, related field or equivalent experience.
7+ years of relevant experience 

As an energy industry leader, our career opportunities fuel personal and professional growth.

Location:

Findlay, Ohio

Job Requisition ID:

00021978

Pay Min/Max:

$122,900.00 - $184,300.00 Salary

Grade:

12

Location Address:

539 S Main St

Additional locations:

Anacortes, Washington, Anchorage, Alaska, Canton, Ohio, Carson, California, Catlettsburg, Kentucky, Catlettsburg KY Refinery, Detroit, Michigan, El Paso, Texas, Garyville, Louisiana, Kenai, Alaska, Mandan, North Dakota, Robinson, Illinois, San Antonio, Texas, Texas City, Texas

Education:

Bachelors: Information Technology

Employee Group:

Full time

Employee Subgroup:

Regular

Marathon Petroleum Company LP is an Equal Opportunity Employer and gives consideration for employment to qualified applicants without discrimination on the basis of race, color, religion, creed, sex, gender (including pregnancy, childbirth, breastfeeding or related medical conditions), sexual orientation, gender identity, gender expression, reproductive health decision-making, age, mental or physical disability, medical condition or AIDS/HIV status, ancestry, national origin, genetic information, military, veteran status, marital status, citizenship  or any other status protected by applicable federal, state, or local laws.  If you would like more information about your EEO rights as an applicant, click here.

If you need a reasonable accommodation for any part of the application process at Marathon Petroleum LP, please contact our Human Resources Department at talentacquisition@marathonpetroleum.com. Please specify the reasonable accommodation you are requesting, along with the job posting number in which you may be interested. A Human Resources representative will review your request and contact you to discuss a reasonable accommodation. Marathon Petroleum offers a total rewards program which includes, but is not limited to, access to health, vision, and dental insurance, paid time off, 401k matching program, paid parental leave, and educational reimbursement. Detailed benefit information is available at mympcbenefits.com. The hired candidate will also be eligible for a discretionary company-sponsored annual bonus program.
 
Equal Opportunity Employer: Veteran / Disability

We will consider all qualified Applicants for employment, including those with arrest or conviction records, in a manner consistent with the requirements of applicable state and local laws. In reviewing criminal history in connection with a conditional offer of employment, Marathon will consider the key responsibilities of the role.

This job is found at InterviewStack.io

Skills

prototypingwireframingagileanalyticsscrum

About Marathon Petroleum Corporation

Marathon Petroleum Corporation is one of the largest petroleum refining, marketing, and transportation companies in the United States. The company operates a complex network of refineries with capacity exceeding 2.9 million barrels per day, markets refined petroleum products globally, and maintains an extensive logistics network through its subsidiary MPLX LP.

enterprise companyenergy, petroleumpublicWebsite