InterviewStack.io LogoInterviewStack.io
Browse more Software Engineer jobs

Senior .NET Software Engineer

Scale3c

Vilnius, Vilniaus, Lithuania€30 - €45/hr1 month ago
89 views45 saves17 applies

Prepare for this role


Job Type

full time

Description

Scale Tech is looking to hire a Senior .NET Software Engineer on behalf of one of our financial services clients.

You will be joining a product-focused team with end-to-end business responsibilities, working on a platform used daily by bank advisers and customers to book and conduct financial advisory meetings. The team operates with a strong focus on code quality, high availability, and continuous improvement.

Location - Vilnius (on-site)

Contract - b2b/freelance

Hourly rate: 30-45 EUR/Hour

Responsibilities:

    • Refactor and reduce complexity of the existing code base

    • Maintain, improve, and develop new features

    • Design and develop cloud-native systems

    • Participate in production releases and incident management

    • Write .NET and Java services

    • Write tests and ensure strong code quality standards

Must-have requirements:

    • .NET – 5+ years of experience

    • Dapper

    • ASP.NET MVC

    • MSSQL / MySQL

    • Redis

    • ElasticSearch

    • Understanding of CI/CD principles

    • Strong ownership, accountability, and code quality focus

    • Upper-Intermediate English (B2+)

Nice-to-have requirements:

    • Java experience (strong bonus)

    • AWS experience

    • Azure DevOps familiarity

We offer:

    • Work in an inspiring environment within a large international IT organisation

    • End-to-end business responsibility within a focused product team.

    • Ongoing training and skill development programme

    • Exposure to modern cloud-native architecture and fintech domain

This job is found at InterviewStack.io

Skills

javaasp.netmysqlrediselasticsearchci/cdawsazure devopsincident managementhigh availability