InterviewStack.io LogoInterviewStack.io
Browse more UX Designer jobs

Advanced Interaction Designer

General Dynamics Mission Systems

Dedham, MA, US$124,216+1 week ago
25 views8 saves3 applies

Prepare for this role


Benefits

Remote Work

Job Type

full time

Description

Basic Qualifications

Bachelor's degree in a related specialized area or field or equivalent combination of education and relevant work experience is required plus a minimum of 5 years of relevant experience; or Master's degree plus a minimum of 3 years of relevant experience.

CLEARANCE REQUIREMENTS:Ability to obtain a Department of Defense SECRET security clearance is required at time of hire. Applicants selected will be subject to a U.S. Government security investigation and must meet eligibility requirements for access to classified information. Due to the nature of work performed within our facilities, U.S. citizenship is required.

Responsibilities for this Position

General Dynamics Mission Systems has an immediate opening for an Advanced Interaction Designer based in the Boston MA area. This position provides an opportunity to further advance the cutting-edge technology that supports some of our nation’s core defense/intelligence services and systems. General Dynamics Mission Systems employees work closely with esteemed customers to develop solutions that allow them to carry out high-stakes national security missions.

What You’ll Do

  • Create graphical user interfaces that meet military standards (MIL-STD-1472), translating complex requirements into elegant, user-centered design solutions that are safe and effective
  • Collaborate effectively with large software development teams, systems engineers, and stakeholders to improve designs and systems based on usability principles
  • Interview subject matter experts and users; produce personas, workflows/journey maps, and other artifacts to inform design decisions
  • Use interface prototyping tools to create low- to high-fidelity wireframes and clickable prototypes across all design phases
  • Apply expertise in usability and interaction design principles across all aspects of visual and interface design
  • Defend design decisions with compelling, research-based rationale and present findings through engaging reports and stakeholder presentations
  • Design development-ready icons and graphics; identify creative alternatives when barriers arise
  • Hybrid work environment with a minimum of 2-3 days per week on site; travel up to 20% to collaborate with clients, teams, and test sites

What You Bring to the Table

  • Expertise in designing for compliance with complex requirements, with a strong understanding of interaction, design, and usability principles
  • Strong knowledge of design systems, optimizing human performance, and evaluating software designs
  • Expertise with wireframing and prototyping tools (e.g., Axure RP, Figma, Sketch) and Adobe CC (especially Illustrator/Photoshop)
  • Excellent communication skills – verbal, written, and visual – including the ability to present findings and defend difficult decisions to teams and leadership in a constructive manner
  • A portfolio demonstrating your design work, the challenges you've overcome, and your passion for making things better for users
  • Ability to work independently, make informed decisions with minimal direction, accept constructive feedback, and thrive in a team environment
  • Ability to obtain a Secret security clearance (U.S. Citizenship required)

What Sets You Apart

  • Experience in defense contractor roles or U.S. Navy programs
  • Identifies and leverages AI as a creative and analytical partner – from accelerating prototyping cycles and conducting contextual research in novel domains, to intuitively knowing how to prompt, iterate, and collaborate with AI tools to push design work further
  • Experience planning and conducting user research
  • Experience with web, mobile, or desktop application development, including working knowledge of CSS and HTML
  • Experience working in an Agile development environment
  • Freehand drawing/sketching skills for rapid ideation

Salary Note

This estimate represents the typical salary range for this position based on experience and other factors (geographic location, etc.). Actual pay may vary. This job posting will remain open until the position is filled.

Combined Salary Range

USD $124,216.00 - USD $131,009.00 /Yr.

Company Overview

General Dynamics Mission Systems (GDMS) engineers a diverse portfolio of high technology solutions, products and services that enable customers to successfully execute missions across all domains of operation. With a global team of 12,000+ top professionals, we partner with the best in industry to expand the bounds of innovation in the defense and scientific arenas. Given the nature of our work and who we are, we value trust, honesty, alignment and transparency. We offer highly competitive benefits and pride ourselves in being a great place to work with a shared sense of purpose. You will also enjoy a flexible work environment where contributions are recognized and rewarded. If who we are and what we do resonates with you, we invite you to join our high-performance team!

Equal Opportunity Employer / Individuals with Disabilities / Protected Veterans

This job is found at InterviewStack.io

Skills

prototypingwireframesdesign systemswireframingfigmasketchcsshtmlagileuser researchinteraction design

About General Dynamics Mission Systems

General Dynamics Mission Systems provides secure, multi-domain C4ISR solutions for defense, intelligence, and public safety customers. Its offerings include secure communications networks, radios, and satellite capabilities, designed to be integrated across land, sea, air, space, and cyber domains.

defense, aerospaceWebsite