InterviewStack.io LogoInterviewStack.io
Browse more Systems Administrator jobs

System Administrator

Leidos

Mons, Belgium$73,450 - $132,7752 days ago
29 views8 saves3 applies

Prepare for this role


Benefits

Remote Work

Job Type

full time

Description

Systems Administrator
Location: Mons, Belgium

The Defense Sector of Leidos has an immediate opening for a Systems Administrator in Mons, Belgium. This role supports critical Army Military Intelligence Enterprise IT systems, ensuring secure, reliable, and uninterrupted operations across a global environment.

As part of a high-performing team, you will provide IT repair, maintenance, operations, logistics, and engineering services in support of mission-critical systems.

Important Note on Start Timeline: Due to the Status of Forces Agreement (SOFA) process required for this position, the onboarding and deployment timeline is typically 3 to 6 months from offer acceptance.

Primary Responsibilities:

  • Troubleshoot, diagnose, and resolve software and system issues across enterprise environments.

  • Support system design activities including testing, implementation, and optimization.

  • Maintain network security through implementation of STIGs and ongoing IAVA compliance.

  • Administer and support enterprise services including: Microsoft Windows Server 2019/ 2022, Active Directory including Group Policy management, MECM, WSUS, DHCP, DNS, Microsoft Exchange, Backup and data protection solutions, Client imaging, File and print services.

  • Perform activities supporting Information Assurance and Network Accreditation requirements.

  • Manage and maintain operating environments including:

    • Red Hat Enterprise Linux v8.10

    • Microsoft Windows Server 2019 and 2022, Windows 11

    • VMware vSphere and ESXi

    • Dell Data Domain systems

Basic Qualifications:

  • Bachelor’s degree with 4+ years of relevant experience, or a Master’s degree with 2+ years of relevant experience. Additional relevant experience, training, or certifications may be considered in lieu of a degree.

  • Active DoD Top Secret clearance with the ability to obtain a TS/SCI prior to start date.

  • Active IAT Level II certification (Security+ CE or higher), or ability to obtain prior to start.

  • Computing Environment: Windows Server, Windows 11, or related system administration certificate/ certification, or the ability to obtain prior to start.

  • Experience administering SCCM/ MECM.

  • Experience working with Red Hat Enterprise Linux v8.10.

  • Experience administering Microsoft Exchange.

  • Experience administering VMware environments.

  • U.S. citizenship and a valid U.S. passport required to obtain SOFA status in Belgium.

Preferred Qualifications:

  • Current operating system certification in Linux or Windows.

  • Microsoft Certified: Windows Server Hybrid Administrator Associate or higher.

  • Experience with SharePoint 2016 or Subscription Edition.

  • Experience with SQL Server 2022.

  • Experience with Dell VxRail and Data Domain storage administration.

  • Experience with Apache Tomcat and PostgreSQL.

  • Experience supporting senior leaders or high-visibility customers in demanding environments.

AMSOPP1

If you're looking for comfort, keep scrolling. At Leidos, we outthink, outbuild, and outpace the status quo — because the mission demands it. We're not hiring followers. We're recruiting the ones who disrupt, provoke, and refuse to fail. Step 10 is ancient history. We're already at step 30 — and moving faster than anyone else dares.

Original Posting:

June 24, 2026

For U.S. Positions: While subject to change based on business needs, Leidos reasonably anticipates that this job requisition will remain open for at least 3 days with an anticipated close date of no earlier than 3 days after the original posting date as listed above.

Pay Range:

Pay Range $73,450.00 - $132,775.00

The Leidos pay range for this job level is a general guideline only and not a guarantee of compensation or salary. Additional factors considered in extending an offer include (but are not limited to) responsibilities of the job, education, experience, knowledge, skills, and abilities, as well as internal equity, alignment with market data, applicable bargaining agreement (if any), or other law.

This job is found at InterviewStack.io

Skills

system designwindows serveractive directorydhcpdnslinuxwindowsvmwaretypescriptsqlapachenetwork securitysystem administration

About Leidos

Leidos is a large American defense, aviation, information technology, and biomedical research company. It provides scientific, engineering, systems integration, and technical services primarily to the United States government. The company is headquartered in Reston, Virginia and employs thousands of people across various locations.

enterprise companydefense, technologypublicWebsite